Q9YGE3 · Q9YGE3_ONCMY
- ProteinCholecystokinin (Leu)
- Genecck-L
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids132 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axon | |
Cellular Component | extracellular space | |
Molecular Function | neuropeptide hormone activity | |
Biological Process | digestion |
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Metazoa (metazoans) > Eumetazoa > Bilateria > Deuterostomia > Chordata (chordates) > Craniata > Vertebrata (vertebrates) > Gnathostomata (jawed vertebrates) > Teleostomi > Euteleostomi (bony vertebrates) > Actinopterygii (ray-finned fishes) > Actinopteri > Neopterygii > Teleostei (teleost fishes) > Osteoglossocephalai > Clupeocephala > Euteleosteomorpha > Protacanthopterygii > Salmoniformes (salmons and trouts) > Salmonidae (salmonids) > Salmoninae (trouts, salmons & chars) > Oncorhynchus
Accessions
- Primary accessionQ9YGE3
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MNAGICVCVLLAAFSGSSLG | ||||||
Chain | PRO_5004337183 | 21-132 | ||||
Sequence: RPSHSQDEDKPEPPQLDSVMSPQHTRHTRSAPSSGQLIPFSKPAEDEAEDPRTSLRELLARLISRKGSLQRSSSLSSEASGPGPSHKIKDRDYLGWMDFGRRSAEEYEEYSS |
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 4-130 | Gastrin/cholecystokinin peptide hormone | ||||
Sequence: GICVCVLLAAFSGSSLGRPSHSQDEDKPEPPQLDSVMSPQHTRHTRSAPSSGQLIPFSKPAEDEAEDPRTSLRELLARLISRKGSLQRSSSLSSEASGPGPSHKIKDRDYLGWMDFGRRSAEEYEEY | ||||||
Region | 17-73 | Disordered | ||||
Sequence: SSLGRPSHSQDEDKPEPPQLDSVMSPQHTRHTRSAPSSGQLIPFSKPAEDEAEDPRT | ||||||
Compositional bias | 38-57 | Polar residues | ||||
Sequence: SVMSPQHTRHTRSAPSSGQL | ||||||
Compositional bias | 86-101 | Polar residues | ||||
Sequence: KGSLQRSSSLSSEASG | ||||||
Region | 86-111 | Disordered | ||||
Sequence: KGSLQRSSSLSSEASGPGPSHKIKDR |
Sequence similarities
Belongs to the gastrin/cholecystokinin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length132
- Mass (Da)14,461
- Last updated1999-05-01 v1
- ChecksumE6029457739DC48C
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 38-57 | Polar residues | ||||
Sequence: SVMSPQHTRHTRSAPSSGQL | ||||||
Compositional bias | 86-101 | Polar residues | ||||
Sequence: KGSLQRSSSLSSEASG |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ012056 EMBL· GenBank· DDBJ | CAA09907.1 EMBL· GenBank· DDBJ | mRNA |