Q9Y6H1 · CHCH2_HUMAN
- ProteinCoiled-coil-helix-coiled-coil-helix domain-containing protein 2
- GeneCHCHD2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids151 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription factor. Binds to the oxygen responsive element of COX4I2 and activates its transcription under hypoxia conditions (4% oxygen), as well as normoxia conditions (20% oxygen) (PubMed:23303788).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial intermembrane space | |
Cellular Component | mitochondrion | |
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor binding | |
Molecular Function | sequence-specific DNA binding | |
Biological Process | cellular response to oxidative stress | |
Biological Process | mitochondrion organization | |
Biological Process | positive regulation of mitochondrial ATP synthesis coupled electron transport | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of cellular response to hypoxia | |
Biological Process | regulation of generation of precursor metabolites and energy |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCoiled-coil-helix-coiled-coil-helix domain-containing protein 2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9Y6H1
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Mainly localized in the intermembrane space.
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Parkinson disease 22 (PARK22)
- Note
- DescriptionAn autosomal dominant form of Parkinson disease, a complex neurodegenerative disorder characterized by bradykinesia, resting tremor, muscular rigidity and postural instability, as well as by a clinically significant response to treatment with levodopa. The pathology involves the loss of dopaminergic neurons in the substantia nigra and the presence of Lewy bodies (intraneuronal accumulations of aggregated proteins), in surviving neurons in various areas of the brain.
- See alsoMIM:616710
Natural variants in PARK22
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_076299 | 61 | T>I | in PARK22; does not affect subcellular location; dbSNP:rs864309650 | |
VAR_076301 | 145 | R>Q | in PARK22; uncertain significance; does not affect subcellular location; dbSNP:rs752169833 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_076293 | 2 | may influence risk for Lewy body disorders; dbSNP:rs142444896 | |||
Sequence: P → L | ||||||
Natural variant | VAR_076294 | 4 | may influence risk for Lewy body disorders; dbSNP:rs778328496 | |||
Sequence: G → R | ||||||
Natural variant | VAR_076295 | 14 | may influence risk for Lewy body disorders; dbSNP:rs137965562 | |||
Sequence: P → S | ||||||
Natural variant | VAR_076296 | 34 | may influence risk for Lewy body disorders; dbSNP:rs371198317 | |||
Sequence: P → L | ||||||
Natural variant | VAR_076297 | 37 | may influence risk for Lewy body disorders; dbSNP:rs1427631250 | |||
Sequence: A → V | ||||||
Natural variant | VAR_076298 | 49 | may influence risk for Lewy body disorders; dbSNP:rs151213700 | |||
Sequence: A → V | ||||||
Natural variant | VAR_076299 | 61 | in PARK22; does not affect subcellular location; dbSNP:rs864309650 | |||
Sequence: T → I | ||||||
Natural variant | VAR_048699 | 78 | in dbSNP:rs11546418 | |||
Sequence: H → N | ||||||
Natural variant | VAR_076300 | 93 | may influence risk for Lewy body disorders; dbSNP:rs748182315 | |||
Sequence: A → V | ||||||
Natural variant | VAR_076301 | 145 | in PARK22; uncertain significance; does not affect subcellular location; dbSNP:rs752169833 | |||
Sequence: R → Q |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 198 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), disulfide bond.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000129160 | 1-151 | UniProt | Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 | |||
Sequence: MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA | |||||||
Modified residue (large scale data) | 41 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Disulfide bond | 114↔144 | UniProt | |||||
Sequence: CLYEIKQFLECAQNQGDIKLCEGFNEVLKQC | |||||||
Disulfide bond | 124↔134 | UniProt | |||||
Sequence: CAQNQGDIKLC |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Interacts with RBPJ.
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-50 | Disordered | ||||
Sequence: MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAP | ||||||
Region | 77-111 | Disordered | ||||
Sequence: GHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQ | ||||||
Domain | 111-151 | CHCH | ||||
Sequence: QQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA | ||||||
Motif | 114-124 | Cx9C motif 1 | ||||
Sequence: CLYEIKQFLEC | ||||||
Motif | 134-144 | Cx9C motif 2 | ||||
Sequence: CEGFNEVLKQC |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length151
- Mass (Da)15,513
- Last updated1999-11-01 v1
- Checksum5403662D8DB4FB86
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 54 | in Ref. 5; AAH66331 | ||||
Sequence: G → V |
Polymorphism
Mutations in CHCHD2 are rare, and might vary by ethnic origin.
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY605046 EMBL· GenBank· DDBJ | AAT35813.1 EMBL· GenBank· DDBJ | mRNA | ||
AF078845 EMBL· GenBank· DDBJ | AAD44477.1 EMBL· GenBank· DDBJ | mRNA | ||
AY633613 EMBL· GenBank· DDBJ | AAV33306.1 EMBL· GenBank· DDBJ | mRNA | ||
AC006970 EMBL· GenBank· DDBJ | AAQ96886.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC003079 EMBL· GenBank· DDBJ | AAH03079.1 EMBL· GenBank· DDBJ | mRNA | ||
BC015639 EMBL· GenBank· DDBJ | AAH15639.1 EMBL· GenBank· DDBJ | mRNA | ||
BC066331 EMBL· GenBank· DDBJ | AAH66331.1 EMBL· GenBank· DDBJ | mRNA | ||
BC071985 EMBL· GenBank· DDBJ | AAH71985.1 EMBL· GenBank· DDBJ | mRNA | ||
BC100275 EMBL· GenBank· DDBJ | AAI00276.1 EMBL· GenBank· DDBJ | mRNA |