Q9Y625 · GPC6_HUMAN
- ProteinGlypican-6
- GeneGPC6
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids555 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Cell surface proteoglycan that bears heparan sulfate. Putative cell surface coreceptor for growth factors, extracellular matrix proteins, proteases and anti-proteases (By similarity).
Enhances migration and invasion of cancer cells through WNT5A signaling
Enhances migration and invasion of cancer cells through WNT5A signaling
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell surface | |
Cellular Component | collagen-containing extracellular matrix | |
Cellular Component | extracellular region | |
Cellular Component | glutamatergic synapse | |
Cellular Component | Golgi lumen | |
Cellular Component | lysosomal lumen | |
Cellular Component | nucleus | |
Cellular Component | plasma membrane | |
Cellular Component | side of membrane | |
Cellular Component | synapse | |
Molecular Function | coreceptor activity | |
Biological Process | cell migration | |
Biological Process | regulation of neurotransmitter receptor localization to postsynaptic specialization membrane | |
Biological Process | regulation of signal transduction |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGlypican-6
- Cleaved into 1 chains
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9Y625
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Lipid-anchor, GPI-anchor
Secreted glypican-6
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Omodysplasia 1 (OMOD1)
- Note
- DescriptionA rare autosomal recessive skeletal dysplasia characterized by facial dysmorphism and severe congenital micromelia with shortening and distal tapering of the humeri and femora, to give a club-like appearance. Typical facial features include a prominent forehead, frontal bossing, short nose with a depressed broad bridge, short columella, anteverted nostrils, long philtrum, and small chin.
- See alsoMIM:258315
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_024229 | 412 | in dbSNP:rs1535692 | |||
Sequence: V → M |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 690 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, lipidation, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-23 | |||||
Sequence: MPSWIGAVILPLLGLLLSLPAGA | ||||||
Chain | PRO_0000333851 | 24-? | Secreted glypican-6 | |||
Sequence: MPSWIGAVILPLLGLLLSLPAGA | ||||||
Chain | PRO_0000012323 | 24-529 | Glypican-6 | |||
Sequence: DVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDTEWNLFIDAMLLVAERLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGCGQPKPAPALRSARSAPENFNTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEEECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRREVDS | ||||||
Lipidation | 529 | GPI-anchor amidated serine | ||||
Sequence: S | ||||||
Propeptide | PRO_0000012324 | 530-555 | Removed in mature form | |||
Sequence: SAAQRGHSLLSWSLTCIVLALQRLCR |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Widely expressed. High expression in fetal kidney and lung and lower expressions in fetal liver and brain. In adult tissues, very abundant in ovary, high levels also observed in liver, kidney, small intestine and colon. Not detected in peripheral blood leukocytes. Detected in breast cancer cells (at protein level).
Induction
Expression is induced by NFATC2.
Gene expression databases
Organism-specific databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9Y625 | GPC4 O75487 | 4 | EBI-3046690, EBI-3050469 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 348-376 | Disordered | ||||
Sequence: PALRSARSAPENFNTRFRPYNPEERPTTA | ||||||
Compositional bias | 480-499 | Polar residues | ||||
Sequence: GNDVNFQDTSDESSGSGSGS | ||||||
Region | 480-501 | Disordered | ||||
Sequence: GNDVNFQDTSDESSGSGSGSGC |
Sequence similarities
Belongs to the glypican family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length555
- Mass (Da)62,736
- Last updated1999-11-01 v1
- ChecksumD3D01480FF9C4152
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 15 | in Ref. 4; BAF82833 | ||||
Sequence: L → P | ||||||
Compositional bias | 480-499 | Polar residues | ||||
Sequence: GNDVNFQDTSDESSGSGSGS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF111178 EMBL· GenBank· DDBJ | AAD31392.1 EMBL· GenBank· DDBJ | mRNA | ||
AF105267 EMBL· GenBank· DDBJ | AAD55749.1 EMBL· GenBank· DDBJ | mRNA | ||
AY358462 EMBL· GenBank· DDBJ | AAQ88827.1 EMBL· GenBank· DDBJ | mRNA | ||
BC106947 EMBL· GenBank· DDBJ | AAI06948.1 EMBL· GenBank· DDBJ | mRNA | ||
AK290144 EMBL· GenBank· DDBJ | BAF82833.1 EMBL· GenBank· DDBJ | mRNA | ||
AL139798 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL160036 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL161426 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL162455 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL354811 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL137144 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |