Q9Y3E0 · GOT1B_HUMAN
- ProteinVesicle transport protein GOT1B
- GeneGOLT1B
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids138 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May be involved in fusion of ER-derived transport vesicles with the Golgi complex.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | Golgi membrane | |
Cellular Component | membrane | |
Cellular Component | protein-containing complex | |
Biological Process | endoplasmic reticulum to Golgi vesicle-mediated transport | |
Biological Process | positive regulation of canonical NF-kappaB signal transduction | |
Biological Process | protein transport | |
Biological Process | retrograde transport, endosome to Golgi |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameVesicle transport protein GOT1B
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9Y3E0
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Golgi apparatus membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-9 | Cytoplasmic | ||||
Sequence: MISLTDTQK | ||||||
Transmembrane | 10-30 | Helical; Name=1 | ||||
Sequence: IGMGLTGFGVFFLFFGMILFF | ||||||
Topological domain | 31-32 | Lumenal | ||||
Sequence: DK | ||||||
Transmembrane | 33-53 | Helical; Name=2 | ||||
Sequence: ALLAIGNVLFVAGLAFVIGLE | ||||||
Topological domain | 54-68 | Cytoplasmic | ||||
Sequence: RTFRFFFQKHKMKAT | ||||||
Transmembrane | 69-89 | Helical; Name=3 | ||||
Sequence: GFFLGGVFVVLIGWPLIGMIF | ||||||
Topological domain | 90 | Lumenal | ||||
Sequence: E | ||||||
Transmembrane | 91-109 | Helical; Name=4 | ||||
Sequence: IYGFFLLFRGFFPVVVGFI | ||||||
Topological domain | 110-138 | Cytoplasmic | ||||
Sequence: RRVPVLGSLLNLPGIRSFVDKVGESNNMV |
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 116 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Modified residue | 1 | N-acetylmethionine | ||||
Sequence: M | ||||||
Chain | PRO_0000218582 | 1-138 | Vesicle transport protein GOT1B | |||
Sequence: MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKVGESNNMV |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Widely expressed. Tends to be up-regulated in seminomas compared to normal testis.
Gene expression databases
Organism-specific databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9Y3E0 | CREB3L1 Q96BA8 | 3 | EBI-4402607, EBI-6942903 | |
BINARY | Q9Y3E0 | GPR152 Q8TDT2 | 3 | EBI-4402607, EBI-13345167 | |
BINARY | Q9Y3E0 | INPP5K Q9BT40 | 3 | EBI-4402607, EBI-749162 | |
BINARY | Q9Y3E0 | MUC1 P15941-11 | 3 | EBI-4402607, EBI-17263240 | |
BINARY | Q9Y3E0 | SAR1A Q9NR31 | 3 | EBI-4402607, EBI-3920694 | |
BINARY | Q9Y3E0 | SDCBP O00560 | 3 | EBI-4402607, EBI-727004 | |
BINARY | Q9Y3E0 | SH3GL3 Q8IVP1 | 3 | EBI-4402607, EBI-6503765 | |
BINARY | Q9Y3E0 | SHISAL2A Q6UWV7 | 3 | EBI-4402607, EBI-18396772 | |
BINARY | Q9Y3E0 | SLC10A6 Q3KNW5 | 3 | EBI-4402607, EBI-18159983 | |
BINARY | Q9Y3E0 | SPG21 Q9NZD8 | 3 | EBI-4402607, EBI-742688 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length138
- Mass (Da)15,426
- Last updated1999-11-01 v1
- Checksum2EB85823C34EFAFA
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 37 | in Ref. 5; AAF65181 | ||||
Sequence: I → T | ||||||
Sequence conflict | 54 | in Ref. 6; CAG33670 | ||||
Sequence: R → K |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF151899 EMBL· GenBank· DDBJ | AAD34136.1 EMBL· GenBank· DDBJ | mRNA | ||
AL136571 EMBL· GenBank· DDBJ | CAB66506.1 EMBL· GenBank· DDBJ | mRNA | ||
AB097020 EMBL· GenBank· DDBJ | BAC77373.1 EMBL· GenBank· DDBJ | mRNA | ||
AY358975 EMBL· GenBank· DDBJ | AAQ89334.1 EMBL· GenBank· DDBJ | mRNA | ||
AF068292 EMBL· GenBank· DDBJ | AAF65181.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
CR457389 EMBL· GenBank· DDBJ | CAG33670.1 EMBL· GenBank· DDBJ | mRNA | ||
AK311920 EMBL· GenBank· DDBJ | BAG34861.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471094 EMBL· GenBank· DDBJ | EAW96443.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC012455 EMBL· GenBank· DDBJ | AAH12455.1 EMBL· GenBank· DDBJ | mRNA |