Q9Y3D2 · MSRB2_HUMAN
- ProteinMethionine-R-sulfoxide reductase B2, mitochondrial
- GeneMSRB2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids182 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Upon oxidative stress, may play a role in the preservation of mitochondrial integrity by decreasing the intracellular reactive oxygen species build-up through its scavenging role, hence contributing to cell survival and protein maintenance.
Catalytic activity
- [thioredoxin]-disulfide + H2O + L-methionyl-[protein] = [thioredoxin]-dithiol + L-methionyl-(R)-S-oxide-[protein]
RHEA-COMP:10700 CHEBI:50058 Position: n/n+3+ CHEBI:15377 + RHEA-COMP:12313 = RHEA-COMP:10698 CHEBI:29950 Position: nCHEBI:29950 Position: n+3+ RHEA-COMP:12314
Cofactor
Note: Binds 1 zinc ion per subunit.
Features
Showing features for binding site, active site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | mitochondrion | |
Molecular Function | actin binding | |
Molecular Function | L-methionine-(R)-S-oxide reductase activity | |
Molecular Function | peptide-methionine (R)-S-oxide reductase activity | |
Molecular Function | zinc ion binding | |
Biological Process | actin filament polymerization | |
Biological Process | protein repair | |
Biological Process | response to oxidative stress |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMethionine-R-sulfoxide reductase B2, mitochondrial
- EC number
- Short namesMsrB2
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9Y3D2
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_050448 | 46 | in dbSNP:rs2296466 | |||
Sequence: E → G |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 217 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-20 | Mitochondrion | ||||
Sequence: MARLLWLLRGLTLGTAPRRA | ||||||
Chain | PRO_0000140324 | 21-182 | Methionine-R-sulfoxide reductase B2, mitochondrial | |||
Sequence: VRGQAGGGGPGTGPGLGEAGSLATCELPLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH |
Proteomic databases
PTM databases
Expression
Tissue specificity
Ubiquitous. Detected in retina, ocular ciliary body, skeletal muscle, heart, colon, bone marrow, cerebellum, small intestine, fetal brain, fetal liver, kidney, spinal cord, lung, placenta and prostate.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with DAOA; the interaction is direct.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9Y3D2 | APBB2 Q92870-2 | 3 | EBI-9092052, EBI-21535880 | |
BINARY | Q9Y3D2 | APOE P02649 | 3 | EBI-9092052, EBI-1222467 | |
BINARY | Q9Y3D2 | DGLUCY Q7Z3D6 | 3 | EBI-9092052, EBI-2807872 | |
BINARY | Q9Y3D2 | ELAVL4 P26378-2 | 3 | EBI-9092052, EBI-21603100 | |
BINARY | Q9Y3D2 | GFAP P14136 | 3 | EBI-9092052, EBI-744302 | |
BINARY | Q9Y3D2 | HTT P42858 | 12 | EBI-9092052, EBI-466029 | |
BINARY | Q9Y3D2 | JPH3 Q8WXH2 | 3 | EBI-9092052, EBI-1055254 | |
BINARY | Q9Y3D2 | NDRG1 Q92597 | 3 | EBI-9092052, EBI-716486 | |
BINARY | Q9Y3D2 | NDUFV2 P19404 | 3 | EBI-9092052, EBI-713665 | |
BINARY | Q9Y3D2 | PEX26 Q7Z412 | 3 | EBI-9092052, EBI-752057 | |
BINARY | Q9Y3D2 | PMP22 A0A6Q8PF08 | 3 | EBI-9092052, EBI-50433196 | |
BINARY | Q9Y3D2 | SNCA P37840 | 3 | EBI-9092052, EBI-985879 | |
BINARY | Q9Y3D2 | TRAF2 Q12933 | 3 | EBI-9092052, EBI-355744 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 51-180 | MsrB | ||||
Sequence: KSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPR |
Sequence similarities
Belongs to the MsrB Met sulfoxide reductase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length182
- Mass (Da)19,536
- Last updated2008-04-08 v2
- ChecksumDFD1D0BF249D45BE
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
H0YE51 | H0YE51_HUMAN | MSRB2 | 120 |
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 63 | in Ref. 6; AAH18030 | ||||
Sequence: F → L |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF122004 EMBL· GenBank· DDBJ | AAD38899.1 EMBL· GenBank· DDBJ | mRNA | ||
AF151889 EMBL· GenBank· DDBJ | AAD34126.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
EF444983 EMBL· GenBank· DDBJ | ACA05998.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL139281 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471072 EMBL· GenBank· DDBJ | EAW86135.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC018030 EMBL· GenBank· DDBJ | AAH18030.1 EMBL· GenBank· DDBJ | mRNA | ||
BC117471 EMBL· GenBank· DDBJ | AAI17472.1 EMBL· GenBank· DDBJ | mRNA | ||
BC130380 EMBL· GenBank· DDBJ | AAI30381.1 EMBL· GenBank· DDBJ | mRNA |