Q9Y2I6 · NINL_HUMAN
- ProteinNinein-like protein
- GeneNINL
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1382 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May play a role in ovarian carcinogenesis
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | centrosome | |
Cellular Component | cytosol | |
Cellular Component | microtubule | |
Molecular Function | calcium ion binding | |
Biological Process | microtubule anchoring at centrosome |
Keywords
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNinein-like protein
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9Y2I6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_059700 | 79 | in dbSNP:rs6115203 | |||
Sequence: G → V | ||||||
Natural variant | VAR_059701 | 191 | in dbSNP:rs34585177 | |||
Sequence: S → R | ||||||
Natural variant | VAR_059702 | 276 | in dbSNP:rs13044759 | |||
Sequence: R → W | ||||||
Natural variant | VAR_059703 | 296 | in dbSNP:rs379538 | |||
Sequence: T → A | ||||||
Mutagenesis | 495-497 | Disrupts binding to CDC20 and FZR1 and prevents ubiquitination and subsequent degradation of NINL; when associated with 633-A--A-636. | ||||
Sequence: KEN → AAA | ||||||
Mutagenesis | 633-636 | Disrupts binding to CDC20 and FZR1 and prevents ubiquitination and subsequent degradation of NINL; when associated with 495-A--A-497. | ||||
Sequence: RTQL → AAAA | ||||||
Natural variant | VAR_058509 | 969 | in dbSNP:rs6115193 | |||
Sequence: R → G | ||||||
Natural variant | VAR_059704 | 973 | in dbSNP:rs428801 | |||
Sequence: E → K | ||||||
Natural variant | VAR_061688 | 1077 | in dbSNP:rs35666277 | |||
Sequence: D → N | ||||||
Natural variant | VAR_061689 | 1276 | in dbSNP:rs41310175 | |||
Sequence: R → C | ||||||
Natural variant | VAR_058510 | 1366 | in dbSNP:rs17857107 | |||
Sequence: R → H |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1,813 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000259714 | 1-1382 | UniProt | Ninein-like protein | |||
Sequence: MDEEENHYVSQLREVYSSCDTTGTGFLDRQELTQLCLKLHLEQQLPVLLQTLLGNDHFARVNFEEFKEGFVAVLSSNAGVRPSDEDSSSLESAASSAIPPKYVNGSKWYGRRSRPELCDAATEARRVPEQQTQASLKSHLWRSASLESVESPKSDEEAESTKEAQNELFEAQGQLQTWDSEDFGSPQKSCSPSFDTPESQIRGVWEELGVGSSGHLSEQELAVVCQSVGLQGLEKEELEDLFNKLDQDGDGKVSLEEFQLGLFSHEPALLLESSTRVKPSKAWSHYQVPEESGCHTTTTSSLVSLCSSLRLFSSIDDGSGFAFPDQVLAMWTQEGIQNGREILQSLDFSVDEKVNLLELTWALDNELMTVDSAVQQAALACYHQELSYQQGQVEQLARERDKARQDLERAEKRNLEFVKEMDDCHSTLEQLTEKKIKHLEQGYRERLSLLRSEVEAERELFWEQAHRQRAALEWDVGRLQAEEAGLREKLTLALKENSRLQKEIVEVVEKLSDSERLALKLQKDLEFVLKDKLEPQSAELLAQEERFAAVLKEYELKCRDLQDRNDELQAELEGLWARLPKNRHSPSWSPDGRRRQLPGLGPAGISFLGNSAPVSIETELMMEQVKEHYQDLRTQLETKVNYYEREIAALKRNFEKERKDMEQARRREVSVLEGQKADLEELHEKSQEVIWGLQEQLQDTARGPEPEQMGLAPCCTQALCGLALRHHSHLQQIRREAEAELSGELSGLGALPARRDLTLELEEPPQGPLPRGSQRSEQLELERALKLQPCASEKRAQMCVSLALEEEELELARGKRVDGPSLEAEMQALPKDGLVAGSGQEGTRGLLPLRPGCGERPLAWLAPGDGRESEEAAGAGPRRRQAQDTEATQSPAPAPAPASHGPSERWSRMQPCGVDGDIVPKEPEPFGASAAGLEQPGARELPLLGTERDASQTQPRMWEPPLRPAASCRGQAERLQAIQEERARSWSRGTQEQASEQQARAEGALEPGCHKHSVEVARRGSLPSHLQLADPQGSWQEQLAAPEEGETKIALEREKDDMETKLLHLEDVVRALEKHVDLRENDRLEFHRLSEENTLLKNDLGRVRQELEAAESTHDAQRKEIEVLKKDKEKACSEMEVLNRQNQNYKDQLSQLNVRVLQLGQEASTHQAQNEEHRVTIQMLTQSLEEVVRSGQQQSDQIQKLRVELECLNQEHQSLQLPWSELTQTLEESQDQVQGAHLRLRQAQAQHLQEVRLVPQDRVAELHRLLSLQGEQARRRLDAQREEHEKQLKATEERVEEAEMILKNMEMLLQEKVDKLKEQFEKNTKSDLLLKELYVENAHLVRALQATEEKQRGAEKQSRLLEEKVRALNKLVSRIAPAALSV | |||||||
Modified residue | 148 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 191 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 585 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 589 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Gene expression databases
Organism-specific databases
Interaction
Subunit
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9Y2I6 | CCDC146 Q8IYE0-2 | 3 | EBI-719716, EBI-10247802 | |
BINARY | Q9Y2I6 | CCHCR1 Q8TD31-3 | 3 | EBI-719716, EBI-10175300 | |
BINARY | Q9Y2I6 | FAM161A Q3B820 | 3 | EBI-719716, EBI-719941 | |
BINARY | Q9Y2I6 | HAUS1 Q96CS2 | 3 | EBI-719716, EBI-2514791 | |
BINARY | Q9Y2I6 | KAT5 Q92993 | 3 | EBI-719716, EBI-399080 | |
BINARY | Q9Y2I6 | L3MBTL4 Q8NA19 | 3 | EBI-719716, EBI-8833581 | |
BINARY | Q9Y2I6 | RBM41 Q96IZ5 | 3 | EBI-719716, EBI-740773 | |
BINARY | Q9Y2I6 | RCOR3 Q9P2K3 | 4 | EBI-719716, EBI-743428 | |
BINARY | Q9Y2I6 | SH2D4A Q9H788 | 3 | EBI-719716, EBI-747035 | |
BINARY | Q9Y2I6 | ZNF417 Q8TAU3 | 4 | EBI-719716, EBI-740727 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias, coiled coil, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 7-42 | EF-hand 1 | ||||
Sequence: HYVSQLREVYSSCDTTGTGFLDRQELTQLCLKLHLE | ||||||
Domain | 41-76 | EF-hand 2 | ||||
Sequence: LEQQLPVLLQTLLGNDHFARVNFEEFKEGFVAVLSS | ||||||
Region | 144-164 | Disordered | ||||
Sequence: ASLESVESPKSDEEAESTKEA | ||||||
Compositional bias | 149-164 | Basic and acidic residues | ||||
Sequence: VESPKSDEEAESTKEA | ||||||
Domain | 196-231 | EF-hand 3 | ||||
Sequence: TPESQIRGVWEELGVGSSGHLSEQELAVVCQSVGLQ | ||||||
Domain | 233-268 | EF-hand 4 | ||||
Sequence: LEKEELEDLFNKLDQDGDGKVSLEEFQLGLFSHEPA | ||||||
Coiled coil | 384-424 | |||||
Sequence: QELSYQQGQVEQLARERDKARQDLERAEKRNLEFVKEMDDC | ||||||
Coiled coil | 484-579 | |||||
Sequence: AGLREKLTLALKENSRLQKEIVEVVEKLSDSERLALKLQKDLEFVLKDKLEPQSAELLAQEERFAAVLKEYELKCRDLQDRNDELQAELEGLWARL | ||||||
Motif | 495-497 | KEN box | ||||
Sequence: KEN | ||||||
Coiled coil | 616-699 | |||||
Sequence: IETELMMEQVKEHYQDLRTQLETKVNYYEREIAALKRNFEKERKDMEQARRREVSVLEGQKADLEELHEKSQEVIWGLQEQLQD | ||||||
Motif | 633-641 | D-box | ||||
Sequence: RTQLETKVN | ||||||
Region | 857-969 | Disordered | ||||
Sequence: PLAWLAPGDGRESEEAAGAGPRRRQAQDTEATQSPAPAPAPASHGPSERWSRMQPCGVDGDIVPKEPEPFGASAAGLEQPGARELPLLGTERDASQTQPRMWEPPLRPAASCR | ||||||
Region | 982-1006 | Disordered | ||||
Sequence: RARSWSRGTQEQASEQQARAEGALE | ||||||
Coiled coil | 1046-1375 | |||||
Sequence: ETKIALEREKDDMETKLLHLEDVVRALEKHVDLRENDRLEFHRLSEENTLLKNDLGRVRQELEAAESTHDAQRKEIEVLKKDKEKACSEMEVLNRQNQNYKDQLSQLNVRVLQLGQEASTHQAQNEEHRVTIQMLTQSLEEVVRSGQQQSDQIQKLRVELECLNQEHQSLQLPWSELTQTLEESQDQVQGAHLRLRQAQAQHLQEVRLVPQDRVAELHRLLSLQGEQARRRLDAQREEHEKQLKATEERVEEAEMILKNMEMLLQEKVDKLKEQFEKNTKSDLLLKELYVENAHLVRALQATEEKQRGAEKQSRLLEEKVRALNKLVSRI |
Domain
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9Y2I6-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsNLP(isoA)
- Length1,382
- Mass (Da)156,344
- Last updated2006-10-31 v2
- Checksum7AB4D464D56A9F28
Q9Y2I6-2
- Name2
- SynonymsNLP(isoB)
- Differences from canonical
- 735-1083: Missing
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
H0Y2V7 | H0Y2V7_HUMAN | NINL | 617 | ||
A0A9L9PYA0 | A0A9L9PYA0_HUMAN | NINL | 474 | ||
A0A9L9PXF7 | A0A9L9PXF7_HUMAN | NINL | 176 |
Sequence caution
Features
Showing features for compositional bias, sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 149-164 | Basic and acidic residues | ||||
Sequence: VESPKSDEEAESTKEA | ||||||
Sequence conflict | 303 | in Ref. 5; BAH11644 | ||||
Sequence: V → L | ||||||
Alternative sequence | VSP_037883 | 735-1083 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 958-959 | in Ref. 4; AAH36380 | ||||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
EU718622 EMBL· GenBank· DDBJ | ACE78295.1 EMBL· GenBank· DDBJ | mRNA | ||
AB023197 EMBL· GenBank· DDBJ | BAA76824.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AL031672 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL161802 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC036380 EMBL· GenBank· DDBJ | AAH36380.1 EMBL· GenBank· DDBJ | mRNA | ||
AK293991 EMBL· GenBank· DDBJ | BAH11644.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |