Q9Y2D2 · S35A3_HUMAN
- ProteinUDP-N-acetylglucosamine transporter
- GeneSLC35A3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids325 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transports diphosphate-N-acetylglucosamine (UDP-GlcNAc) from the cytosol into the lumen of the Golgi apparatus, functioning as an antiporter that exchanges UDP-N-acetyl-alpha-D-glucosamine for UMP (PubMed:10393322).
May supply UDP-GlcNAc as substrate for Golgi-resident glycosyltransferases that generate highly branched, multiantennary complex N-glycans and keratan sulfate (PubMed:23766508, PubMed:34981577).
However, the exact role of SLC35A3 still needs to be elucidated, it could be a member of a catalytically more efficient multiprotein complex rather than function independently as a single transporter (PubMed:32938718).
May supply UDP-GlcNAc as substrate for Golgi-resident glycosyltransferases that generate highly branched, multiantennary complex N-glycans and keratan sulfate (PubMed:23766508, PubMed:34981577).
However, the exact role of SLC35A3 still needs to be elucidated, it could be a member of a catalytically more efficient multiprotein complex rather than function independently as a single transporter (PubMed:32938718).
Catalytic activity
- UDP-N-acetyl-alpha-D-glucosamine(in) + UMP(out) = UDP-N-acetyl-alpha-D-glucosamine(out) + UMP(in)
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Golgi apparatus | |
Cellular Component | Golgi membrane | |
Molecular Function | antiporter activity | |
Molecular Function | UDP-galactose transmembrane transporter activity | |
Molecular Function | UDP-N-acetylglucosamine transmembrane transporter activity | |
Biological Process | UDP-galactose transmembrane import into Golgi lumen | |
Biological Process | UDP-N-acetylglucosamine metabolic process | |
Biological Process | UDP-N-acetylglucosamine transmembrane transport |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameUDP-N-acetylglucosamine transporter
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9Y2D2
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Golgi apparatus membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 8-24 | Helical | ||||
Sequence: VSLGILVFQTTSLVLTM | ||||||
Transmembrane | 42-58 | Helical | ||||
Sequence: AVVVAELLKIMACILLV | ||||||
Transmembrane | 138-154 | Helical | ||||
Sequence: VYQWLSLVILMTGVAFV | ||||||
Transmembrane | 173-189 | Helical | ||||
Sequence: FVGLMAVLTACFSSGFA | ||||||
Transmembrane | 209-225 | Helical | ||||
Sequence: IQLGFFGSIFGLMGVYI | ||||||
Transmembrane | 246-262 | Helical | ||||
Sequence: IVVVLQALGGLVIAAVI | ||||||
Transmembrane | 268-284 | Helical | ||||
Sequence: ILKGFATSLSIILSTLI | ||||||
Transmembrane | 295-311 | Helical | ||||
Sequence: TSVFFLGAILVITATFL |
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Arthrogryposis, impaired intellectual development, and seizures (AMRS)
- Note
- DescriptionA disease characterized by arthrogryposis, intellectual disability, autism spectrum disorder, and epilepsy. Additional features include limb malformations, distal joint involvement, microcephaly, retromicrognathia, and general muscle hypotonia.
- See alsoMIM:615553
Natural variants in AMRS
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_087691 | 25 | R>C | in AMRS |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_087691 | 25 | in AMRS | |||
Sequence: R → C |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 312 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000213357 | 1-325 | UDP-N-acetylglucosamine transporter | |||
Sequence: MFANLKYVSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYIYDGELVSKNGFFQGYNRLTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFLGAILVITATFLYGYDPKPAGNPTKA |
Post-translational modification
O-Glcnacylation regulates the stability of SLC35A3 and the specific complex formation with MGAT4B.
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with SLC35A2; the interaction is reduced in the presence of SLC35A4 (PubMed:23089177, PubMed:28167211).
Found in a complex with SLC35A2 and SLC35A4 (PubMed:28167211).
Interacts with MGAT4B (PubMed:34981577).
Found in a complex with SLC35A2 and SLC35A4 (PubMed:28167211).
Interacts with MGAT4B (PubMed:34981577).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9Y2D2 | SLC35A2 P78381-1 | 3 | EBI-3917581, EBI-8101118 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q9Y2D2-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length325
- Mass (Da)35,985
- Last updated1999-11-01 v1
- Checksum69DFD944E37206C8
Q9Y2D2-2
- Name2
- Differences from canonical
- 1-1: M → MSSRSVLSPVVGTDAPDQHLELKKPQELKEMERLPLANEDKTM
Q9Y2D2-3
- Name3
Computationally mapped potential isoform sequences
There are 21 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1W2PP85 | A0A1W2PP85_HUMAN | SLC35A3 | 69 | ||
A0A1W2PPW2 | A0A1W2PPW2_HUMAN | SLC35A3 | 80 | ||
A0A1W2PQ13 | A0A1W2PQ13_HUMAN | 689 | |||
A0A1W2PQ60 | A0A1W2PQ60_HUMAN | SLC35A3 | 328 | ||
A0A1W2PPG9 | A0A1W2PPG9_HUMAN | 307 | |||
A0A1W2PPH4 | A0A1W2PPH4_HUMAN | SLC35A3 | 315 | ||
A0A1W2PPE6 | A0A1W2PPE6_HUMAN | 299 | |||
A0A1W2PNY6 | A0A1W2PNY6_HUMAN | SLC35A3 | 318 | ||
A0A1W2PNF0 | A0A1W2PNF0_HUMAN | SLC35A3 | 287 | ||
A0A1W2PSD1 | A0A1W2PSD1_HUMAN | SLC35A3 | 269 | ||
A0A1W2PR66 | A0A1W2PR66_HUMAN | SLC35A3 | 155 | ||
A0A1W2PQH2 | A0A1W2PQH2_HUMAN | SLC35A3 | 296 | ||
A0A1W2PQL8 | A0A1W2PQL8_HUMAN | SLC35A3 | 228 | ||
A0A1W2PQD6 | A0A1W2PQD6_HUMAN | 218 | |||
A0A1W2PSA9 | A0A1W2PSA9_HUMAN | 713 | |||
A0A1W2PRT7 | A0A1W2PRT7_HUMAN | SLC35A3 | 284 | ||
A0A1W2PS45 | A0A1W2PS45_HUMAN | 266 | |||
A0A1W2PS77 | A0A1W2PS77_HUMAN | 243 | |||
A0A1W2PRN3 | A0A1W2PRN3_HUMAN | SLC35A3 | 257 | ||
A0A1C7CYW3 | A0A1C7CYW3_HUMAN | SLC35A3 | 65 | ||
E9PPQ9 | E9PPQ9_HUMAN | SLC35A3 | 61 |
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB021981 EMBL· GenBank· DDBJ | BAA77841.1 EMBL· GenBank· DDBJ | mRNA | ||
AK290573 EMBL· GenBank· DDBJ | BAF83262.1 EMBL· GenBank· DDBJ | mRNA | ||
CR749816 EMBL· GenBank· DDBJ | CAH18676.1 EMBL· GenBank· DDBJ | mRNA | ||
AC118553 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471097 EMBL· GenBank· DDBJ | EAW72977.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471097 EMBL· GenBank· DDBJ | EAW72978.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471097 EMBL· GenBank· DDBJ | EAW72979.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC005136 EMBL· GenBank· DDBJ | AAH05136.1 EMBL· GenBank· DDBJ | mRNA |