Q9Y048 · DTN1_CAEEL
- ProteinDystrobrevin-1
- Genedyb-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids590 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a role in cholinergic transmission and as a functional partner of dystrophin (dys-1), necessary for muscle maintenance.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 264 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 267 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 279 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 282 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 288 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 291 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 301 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 305 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: H |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | dystrobrevin complex | |
Cellular Component | dystrophin-associated glycoprotein complex | |
Cellular Component | plasma membrane | |
Cellular Component | synapse | |
Molecular Function | acetylcholine transmembrane transporter activity | |
Molecular Function | cytoskeletal protein binding | |
Molecular Function | zinc ion binding | |
Biological Process | acetylcholine transport | |
Biological Process | establishment of synaptic specificity at neuromuscular junction | |
Biological Process | locomotory behavior | |
Biological Process | muscle cell cellular homeostasis | |
Biological Process | positive regulation of locomotion | |
Biological Process | positive regulation of synaptic transmission, cholinergic | |
Biological Process | sarcomere organization | |
Biological Process | synaptic signaling | |
Biological Process | synaptic transmission, cholinergic |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameDystrobrevin-1
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ9Y048
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Mutants synergistically exhibit progressive myopathy. In dyb-1 and hlh-1 double mutants, there is an uncoordinated phenotype associated with some muscle degeneration. Overexpression of dyb-1 in dys-1 and hlh-1 double mutants delays, but does not prevent the onset and progression of myopathy.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000080035 | 1-590 | Dystrobrevin-1 | |||
Sequence: MLWSNGGGGPREPSSAPSPDHHRAMHSVPPIVASEMQQLIDEMRLQDFDSIRFATYRAACKLRFIQQKTKVHLVDIWNMIEAFRENGLNALPLHTVIKTSRAELLLTTVFHNLNKRLVASQHVDTDVSISLLLAFLLGAYDKQNTGRLTVFSIKVALATLCAGKLVDKLRYIFSQIADSNGLMDHIKFTDFLQQILSLTTAVFEAPTFGFSENAVNQCFHKDEKVSLNVFLDTFLSDPCPPCIMWLPLLHRMASVSNVYHPVVCDACQVRSFTGFRYKCQRCANYQLCQSCFWRGRTSQNHSNEHEMKEYSSYKSPTKQLVHSIHKSLQCIPATSTVGDANIDIFNAKIGGPVSSKPARPLNLNNIVPATPTTIRRQHAATSSADWPTSPVLLPGQASHGGVIDDEHKLIARYAAKLSGRADYPLSNGRSMNSSMVGDERTLIAQLEEENSMMVREMARLESQTTSDDGLAGLRDRKMELEEKMFEMQQRRRELMMQLEHLMAQLNTGPQPSGGVSSASLSQLPFTASDQQLTGVNSTVANAFRAGSLPATSLQGDLLHAADQITTNMSDLVRQLDLAQSDENGVTINGF |
Proteomic databases
PTM databases
Expression
Tissue specificity
From late embryogenesis to adulthood, expressed in neurons and muscles; particularly strong in the ventral nerve cord and in muscles of the body wall, head pharyngeal, and vulva; weaker in the intestinal muscle (at protein level).
Gene expression databases
Interaction
Subunit
Component of the dystrophin glycoprotein complex (DGC). Interacts with dys-1 and syntrophin (stn-1) to form the DGC.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9Y048 | dys-1 Q9TW65 | 4 | EBI-322698, EBI-446952 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, zinc finger, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-25 | Disordered | ||||
Sequence: MLWSNGGGGPREPSSAPSPDHHRAM | ||||||
Zinc finger | 259-315 | ZZ-type | ||||
Sequence: YHPVVCDACQVRSFTGFRYKCQRCANYQLCQSCFWRGRTSQNHSNEHEMKEYSSYKS | ||||||
Coiled coil | 434-508 | |||||
Sequence: SMVGDERTLIAQLEEENSMMVREMARLESQTTSDDGLAGLRDRKMELEEKMFEMQQRRRELMMQLEHLMAQLNTG | ||||||
Region | 484-490 | Essential for interaction with dys-1 | ||||
Sequence: MFEMQQR |
Domain
The coiled-coil domain mediates the specific interaction with dys-1.
Sequence similarities
Belongs to the dystrophin family. Dystrobrevin subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9Y048-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Namea
- Length590
- Mass (Da)65,427
- Last updated1999-11-01 v1
- ChecksumCA0ACD6D54AEBB2A
Q9Y048-2
- Nameb
- Differences from canonical
- 1-78: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
W6RY31 | W6RY31_CAEEL | dyb-1 | 23 |
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_062387 | 1-78 | in isoform b | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ131742 EMBL· GenBank· DDBJ | CAA10498.1 EMBL· GenBank· DDBJ | mRNA | ||
FO081322 EMBL· GenBank· DDBJ | CCD70779.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284601 EMBL· GenBank· DDBJ | CDM63535.1 EMBL· GenBank· DDBJ | Genomic DNA |