Q9XXM8 · NHR68_CAEEL
- ProteinNuclear hormone receptor family member nhr-68
- Genenhr-68
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids385 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Probable transcription factor that acts in a feed-forward loop with nhr-10 to activate genes, including itself, involved in the vitamin B12-independent breakdown of the short-chain fatty acid propionate (PubMed:30625328).
This pathway is triggered in response to a diet low in vitamin B12, when canonical vitamin B12-dependent propionate breakdown cannot function; the resulting accumulation of propionate is probably sensed by nhr-68 and/or nhr-10 (PubMed:30625328).
This pathway is triggered in response to a diet low in vitamin B12, when canonical vitamin B12-dependent propionate breakdown cannot function; the resulting accumulation of propionate is probably sensed by nhr-68 and/or nhr-10 (PubMed:30625328).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 4-79 | Nuclear receptor | ||||
Sequence: KEVCLVCQDFSSGYHYGIPSCNGCKTFFRRTVMKKQKFVCQFDQNCPVDKSIRCACRFCRFEKCLKVGMDKTSLQA |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | nucleus | |
Molecular Function | nuclear receptor activity | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Molecular Function | zinc ion binding | |
Biological Process | cell differentiation | |
Biological Process | propionate catabolic process | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNuclear hormone receptor family member nhr-68
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ9XXM8
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown abolishes expression of acdh-1 when diet is supplemented with 5 nM vitamin B12 and high levels (40 mM) of propionate.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000451998 | 1-385 | Nuclear hormone receptor family member nhr-68 | |||
Sequence: MENKEVCLVCQDFSSGYHYGIPSCNGCKTFFRRTVMKKQKFVCQFDQNCPVDKSIRCACRFCRFEKCLKVGMDKTSLQASRDPIGYTKRNKKTLRHPMNELSGDESNSCTPDRQLSPLRSFENSLNFLAVRERSANELRMSSYLPKRSLKQALCSKPLINDPIFMSKHATVSPRHTFEKLRFITQDDYHYWHERDWFVLTEYAKTFKVFKNMPYHDKTELVCHAAIVIPVLNQVYNSPDYGLDTVVFPDGTYYDRTHEPTRPAGLNRKKYQVLDLVLKPFREMEINFNEFAAFKAITFLNPDADISLESKHAINEERVLITKQLYAYMVQKDGLEKAIYRFGRLILMGTSMSKMACESKEAVWIADFFENIGFTSFAKELIFGDH |
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for zinc finger, region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Zinc finger | 7-27 | NR C4-type | ||||
Sequence: CLVCQDFSSGYHYGIPSCNGC | ||||||
Zinc finger | 43-62 | NR C4-type | ||||
Sequence: CQFDQNCPVDKSIRCACRFC | ||||||
Region | 81-110 | Disordered | ||||
Sequence: RDPIGYTKRNKKTLRHPMNELSGDESNSCT | ||||||
Compositional bias | 85-99 | Basic and acidic residues | ||||
Sequence: GYTKRNKKTLRHPMN | ||||||
Domain | 145-384 | NR LBD | ||||
Sequence: PKRSLKQALCSKPLINDPIFMSKHATVSPRHTFEKLRFITQDDYHYWHERDWFVLTEYAKTFKVFKNMPYHDKTELVCHAAIVIPVLNQVYNSPDYGLDTVVFPDGTYYDRTHEPTRPAGLNRKKYQVLDLVLKPFREMEINFNEFAAFKAITFLNPDADISLESKHAINEERVLITKQLYAYMVQKDGLEKAIYRFGRLILMGTSMSKMACESKEAVWIADFFENIGFTSFAKELIFGD | ||||||
Region | 373-384 | AF-2 | ||||
Sequence: FTSFAKELIFGD |
Sequence similarities
Belongs to the nuclear hormone receptor family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length385
- Mass (Da)44,827
- Last updated1999-11-01 v1
- Checksum18D4C2A660825322
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
H8ESE6 | H8ESE6_CAEEL | nhr-68 | 103 |
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 85-99 | Basic and acidic residues | ||||
Sequence: GYTKRNKKTLRHPMN | ||||||
Sequence conflict | 339 | in Ref. 1; AAO39181 | ||||
Sequence: Y → F |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY204177 EMBL· GenBank· DDBJ | AAO39181.1 EMBL· GenBank· DDBJ | mRNA | ||
BX284605 EMBL· GenBank· DDBJ | CAA18351.1 EMBL· GenBank· DDBJ | Genomic DNA |