Q9XWR1 · FLH1_CAEEL
- ProteinFLYWCH transcription factor 1
- Geneflh-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids507 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Probable transcription factor (PubMed:18794349).
Binds to the DNA sequence motif 5'-[AG]GGCGCCG-3' in the promoters of target genes, including micro-RNA genes, in order to repress expression, and acting redundantly with flh-2 (PubMed:18794349).
Binds to the DNA sequence motif 5'-[AG]GGCGCCG-3' in the promoters of target genes, including micro-RNA genes, in order to repress expression, and acting redundantly with flh-2 (PubMed:18794349).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | metal ion binding | |
Molecular Function | sequence-specific DNA binding | |
Biological Process | negative regulation of DNA-templated transcription | |
Biological Process | nematode larval development |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Recommended nameFLYWCH transcription factor 1
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ9XWR1
- Secondary accessions
Proteomes
Organism-specific databases
Phenotypes & Variants
Disruption phenotype
Knockout, in a flh-2 mutant background, causes poor coordination, egg-laying defects and dumpy appearance (PubMed:18794349).
Causes a ninefold to 10-fold decrease in lin-14 level in embryos and about 2-fold increase in the levels of micro-RNAs lin-4 and mir-241 (PubMed:18794349).
Despite the increase in lin-4 expression, post-embryonic heterochronic defects are not observed (PubMed:18794349).
RNAi-mediated knockdown causes precocious embryonic expression of micro-RNA lin-4, exacerbated by simultaneous RNAi-mediated knockdown of flh-2 (PubMed:18794349).
Causes a ninefold to 10-fold decrease in lin-14 level in embryos and about 2-fold increase in the levels of micro-RNAs lin-4 and mir-241 (PubMed:18794349).
Despite the increase in lin-4 expression, post-embryonic heterochronic defects are not observed (PubMed:18794349).
RNAi-mediated knockdown causes precocious embryonic expression of micro-RNA lin-4, exacerbated by simultaneous RNAi-mediated knockdown of flh-2 (PubMed:18794349).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000453579 | 1-507 | FLYWCH transcription factor 1 | |||
Sequence: MYSPESMNSNISSPSPPSSSSLNAPSLADAPEVRSDDGEAETSEPSTSVTAVPMEIVSQASTSAPVNQLLASGIDMSSVIKNNAVLQALLASASAGGFGDNAGLTMSKLLTAALANGSTAVAKRDAGSPRTDIPKKTRLKVFSNGFFMTFDKLSSCQKKYFWRCEYKNTCKARMHTDIVTEKILTFIHEHNHSAPIDEEVRLYGLDPTNIERNRVYIVGNVADPNQRRKIRKQVADREAAAKRLVQQQEEEQQKQQSASSIVAARAAYAQAMQNGSIPTSSGVASFLQSTSATAPMTSHSMLLAQMPFLNNIKTEMSNMVKNEQFTPERYTQHMSPNLPLQTATIAPLIIPTENYDSPSYRQPAIKRKATDLTNEEHDLRRDPMFQPTFELARKLRKLWKGEPNRYPRTTTTPTHHFEFFLSKNDGTDEHLYVPMRINLRDEAHLKEALQDFCGQQCIGMLLFGISPKISVMFNQPMLNNWDNNQFFLLDISNPSRWRLMYVDDQAV |
Proteomic databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-26 | Polar residues | ||||
Sequence: MYSPESMNSNISSPSPPSSSSLNAPS | ||||||
Region | 1-51 | Disordered | ||||
Sequence: MYSPESMNSNISSPSPPSSSSLNAPSLADAPEVRSDDGEAETSEPSTSVTA | ||||||
Zinc finger | 135-192 | FLYWCH-type | ||||
Sequence: KKTRLKVFSNGFFMTFDKLSSCQKKYFWRCEYKNTCKARMHTDIVTEKILTFIHEHNH |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q9XWR1-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Namea
- Length507
- Mass (Da)56,565
- Last updated2004-07-05 v2
- Checksum8E4E88625E02545A
Q9XWR1-2
- Nameb
- Differences from canonical
- 339-341: Missing
Q9XWR1-3
- Namec
- Differences from canonical
- 1-6: Missing
Features
Showing features for alternative sequence, compositional bias.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX284604 EMBL· GenBank· DDBJ | CAA21587.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284604 EMBL· GenBank· DDBJ | CAO82067.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284604 EMBL· GenBank· DDBJ | CBK19487.1 EMBL· GenBank· DDBJ | Genomic DNA |