Q9XWI6 · EIF3B_CAEEL
- ProteinEukaryotic translation initiation factor 3 subunit B
- Geneeif-3.B
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids725 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | eukaryotic 43S preinitiation complex | |
Cellular Component | eukaryotic 48S preinitiation complex | |
Cellular Component | eukaryotic translation initiation factor 3 complex | |
Molecular Function | RNA binding | |
Molecular Function | translation initiation factor activity | |
Molecular Function | translation initiation factor binding | |
Biological Process | formation of cytoplasmic translation initiation complex | |
Biological Process | regulation of translational initiation | |
Biological Process | translational initiation |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameEukaryotic translation initiation factor 3 subunit B
- Short nameseIF3b
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ9XWI6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Extended lifespan in adults.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000363789 | 1-725 | Eukaryotic translation initiation factor 3 subunit B | |||
Sequence: MVEIDFNKENEEDFSDPPGFVDDVTDDVLVPDVLHKKPTIDEFEDNCVFIAGIPVVGADRLGKLQSVLKKVLERLDPAVKLYIPPSPEGGCLGVLLTEWADQRSAQFAVKSLNGYAFDKNHTFTARSFKDMKQLEAPSDHWTTPEKQAYNDVGDLWWWLQNERCRDQFAISHDKLGVPTVGVFTNMKGNDPELAGDADKAERANWTETVFTWSPHGSYLSTIHKQGIILWGGKDYARAHRFAHTNVQYIDFSPCETYLVTYAAPEESNSWGDCEKDSLRIWDVRTGELKKAFSTFELTGRTQLPTWPFFRWSFDEKYFACLKAPEKDKLEREQKINGISIFESEKFELYEGRPVNIENIKQFEWSPTSTVLAYYSECTDAVPAEFGLLQVPSMQRLRSARVHNVADAQMFWQKSGKRLAFYTMRFKKKEYRETGEVKYVGGCQYHVDIFEIDKKDVSLMNLPLSEPFIHFDWDPEGDKFCVLVGNTAKATPQVYKIEANSHAPKLVSKLDAGVHFNEVQFAPKGGWLAVLAKVSAGGNVYFIDTSLSEAKRTNVIEHPLFNKGYWDPTGRYFVTCSTLGGRAGADLGYRIFTFQGRELCRKNLDRLAQFKWRPRPPVKLSEQKQREIKKNLKKTAAKFIKQDDDEKCRASQEVVEKRRKIMAAFDIIRSRNREQLDATRDERISLRNGVDTEAQLDEDEFVDEEITIALSTSKTQAPLTEEEMRD |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 46-130 | RRM | ||||
Sequence: NCVFIAGIPVVGADRLGKLQSVLKKVLERLDPAVKLYIPPSPEGGCLGVLLTEWADQRSAQFAVKSLNGYAFDKNHTFTARSFKD | ||||||
Repeat | 202-240 | WD 1 | ||||
Sequence: RANWTETVFTWSPHGSYLSTIHKQGIILWGGKDYARAHR | ||||||
Repeat | 242-280 | WD 2 | ||||
Sequence: AHTNVQYIDFSPCETYLVTYAAPEESNSWGDCEKDSLRI | ||||||
Repeat | 354-395 | WD 3 | ||||
Sequence: VNIENIKQFEWSPTSTVLAYYSECTDAVPAEFGLLQVPSMQR | ||||||
Repeat | 462-504 | WD 4 | ||||
Sequence: PLSEPFIHFDWDPEGDKFCVLVGNTAKATPQVYKIEANSHAPK | ||||||
Repeat | 510-552 | WD 5 | ||||
Sequence: DAGVHFNEVQFAPKGGWLAVLAKVSAGGNVYFIDTSLSEAKRT | ||||||
Repeat | 554-594 | WD 6 | ||||
Sequence: VIEHPLFNKGYWDPTGRYFVTCSTLGGRAGADLGYRIFTFQ |
Sequence similarities
Belongs to the eIF-3 subunit B family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9XWI6-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Namea
- Length725
- Mass (Da)83,065
- Last updated2013-07-24 v2
- ChecksumC73A8E862A32F887
Q9XWI6-2
- Nameb
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX284602 EMBL· GenBank· DDBJ | CAA21681.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284602 EMBL· GenBank· DDBJ | CAE46682.2 EMBL· GenBank· DDBJ | Genomic DNA |