Q9XTG7 · AKT2_CAEEL
- ProteinSerine/threonine-protein kinase akt-2
- Geneakt-2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids528 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Acts downstream of PI3 kinase age-1 and kinase pdk-1 in the daf-2/insulin receptor-like transduction pathway (PubMed:10364160, PubMed:11381260, PubMed:11747825, PubMed:15068796, PubMed:18782349, PubMed:22916022, PubMed:9716402).
Essential role in regulating developmental arrest at the dauer stage (PubMed:10364160).
Phosphorylates Forkhead-related daf-16 and the longevity-promoting skn-1 transcription factors, which inhibits their entry into the nucleus and antagonizes their functions (PubMed:11381260, PubMed:11747825, PubMed:15068796, PubMed:18358814).
Role in immune function and pathogen resistance (PubMed:18782349).
Downstream of age-1 and together with akt-1 and sgk-1, promotes cell survival during embryonic development (PubMed:25383666).
Plays a role in maintaining the gonadal basement membrane through antagonizing akt-1 activity (PubMed:22916022).
Essential role in regulating developmental arrest at the dauer stage (PubMed:10364160).
Phosphorylates Forkhead-related daf-16 and the longevity-promoting skn-1 transcription factors, which inhibits their entry into the nucleus and antagonizes their functions (PubMed:11381260, PubMed:11747825, PubMed:15068796, PubMed:18358814).
Role in immune function and pathogen resistance (PubMed:18782349).
Downstream of age-1 and together with akt-1 and sgk-1, promotes cell survival during embryonic development (PubMed:25383666).
Plays a role in maintaining the gonadal basement membrane through antagonizing akt-1 activity (PubMed:22916022).
Catalytic activity
- ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein]
Cofactor
Activity regulation
Phosphorylated and activated by pdk-1.
Features
Showing features for binding site, active site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | protein kinase complex | |
Molecular Function | ATP binding | |
Molecular Function | metal ion binding | |
Molecular Function | phosphatidylinositol-3,4,5-trisphosphate binding | |
Molecular Function | protein kinase activity | |
Molecular Function | protein serine kinase activity | |
Molecular Function | protein serine/threonine kinase activity | |
Biological Process | determination of adult lifespan | |
Biological Process | innate immune response | |
Biological Process | insulin receptor signaling pathway | |
Biological Process | intracellular signal transduction | |
Biological Process | regulation of gene expression | |
Biological Process | regulation of synaptic assembly at neuromuscular junction |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSerine/threonine-protein kinase akt-2
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ9XTG7
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Phenotypes & Variants
Disruption phenotype
Defective egg-laying and increased resistance to pathogens. Simultaneous knockdown of akt-1 and akt-2 result in dauer formation and a weak extension to life span.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 209 | Probable loss of kinase activity. Increased apoptosis during embryonic development in an akt-1 tm399 mutant background. | ||||
Sequence: K → M |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000085616 | 1-528 | Serine/threonine-protein kinase akt-2 | |||
Sequence: MSTENAHLQKEDIVIESWLHKKGEHIRNWRPRYFILFRDGTLLGFRSKPKEDQPLPEPLNNFMIRDAATVCLDKPRPNMFIVRCLQWTTVIERTFYADSADFRQMWIEAIQAVSSHNRLKENAGNTSMQEEDTNGNPSGESDVNMDATSTRSDNDFESTVMNIDEPEEVPRKNTVTMDDFDFLKVLGQGTFGKVILCREKSSDKLYAIKIIRKEMVVDRSEVAHTLTENRVLYACVHPFLTLLKYSFQAQYHICFVMEFANGGELFTHLQRCKTFSEARTRFYGSEIILALGYLHHRNIVYRDMKLENLLLDRDGHIKITDFGLCKEEIKYGDKTSTFCGTPEYLAPEVIEDIDYDRSVDWWGVGVVMYEMMCGRLPFSAKENGKLFELITTCDLKFPNRLSPEAVTLLSGLLERVPAKRLGAGPDDAREVSRAEFFKDVDWEATLRKEVEPPFKPNVMSETDTSFFDREFTSMPVQLTPPRRGEELPTVDEEEELQANFIQFASYYVSGSLERSYDTNRSADKYEIR |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in neurons, muscle cells of the pharynx, rectal gland cells, and spermatheca.
Developmental stage
Expressed in late stage embryos and throughout life.
Gene expression databases
Interaction
Subunit
Interacts with pdk-1, sgk-1, akt-1 and daf-16. Part of a complex containing sgk-1, akt-1 and akt-2.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9XTG7 | akt-1 Q17941 | 2 | EBI-320656, EBI-1770718 | |
BINARY | Q9XTG7 | daf-16 O16850 | 3 | EBI-320656, EBI-324028 | |
BINARY | Q9XTG7 | sgk-1 Q2PJ68 | 3 | EBI-320656, EBI-1770776 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 12-115 | PH | ||||
Sequence: DIVIESWLHKKGEHIRNWRPRYFILFRDGTLLGFRSKPKEDQPLPEPLNNFMIRDAATVCLDKPRPNMFIVRCLQWTTVIERTFYADSADFRQMWIEAIQAVSS | ||||||
Region | 121-153 | Disordered | ||||
Sequence: ENAGNTSMQEEDTNGNPSGESDVNMDATSTRSD | ||||||
Domain | 180-437 | Protein kinase | ||||
Sequence: FDFLKVLGQGTFGKVILCREKSSDKLYAIKIIRKEMVVDRSEVAHTLTENRVLYACVHPFLTLLKYSFQAQYHICFVMEFANGGELFTHLQRCKTFSEARTRFYGSEIILALGYLHHRNIVYRDMKLENLLLDRDGHIKITDFGLCKEEIKYGDKTSTFCGTPEYLAPEVIEDIDYDRSVDWWGVGVVMYEMMCGRLPFSAKENGKLFELITTCDLKFPNRLSPEAVTLLSGLLERVPAKRLGAGPDDAREVSRAEFF | ||||||
Domain | 438-515 | AGC-kinase C-terminal | ||||
Sequence: KDVDWEATLRKEVEPPFKPNVMSETDTSFFDREFTSMPVQLTPPRRGEELPTVDEEEELQANFIQFASYYVSGSLERS |
Domain
The PH domain binds to phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3) resulting in its targeting to the plasma membrane.
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9XTG7-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Namea
- Length528
- Mass (Da)61,058
- Last updated1999-11-01 v1
- Checksum9750E8F0AE4F6AE7
Q9XTG7-2
- Nameb
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF072381 EMBL· GenBank· DDBJ | AAC62468.1 EMBL· GenBank· DDBJ | mRNA | ||
BX284606 EMBL· GenBank· DDBJ | CAA20936.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z92837 EMBL· GenBank· DDBJ | CAA20936.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284606 EMBL· GenBank· DDBJ | CAC70087.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z92837 EMBL· GenBank· DDBJ | CAC70087.1 EMBL· GenBank· DDBJ | Genomic DNA |