Q9XTF3 · MBK2_CAEEL
- ProteinDual specificity tyrosine-phosphorylation-regulated kinase mbk-2
- Genembk-2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids817 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Required for oocyte-to-zygote transition in which it phosphorylates oocyte proteins, including mei-1, oma-1, oma-2, mex-5, and mex-6, modifying their activity and/or stability following meiosis (PubMed:16289132, PubMed:16338136, PubMed:17869113, PubMed:18199581, PubMed:18854162, PubMed:19879842).
Through phosphorylation of P granule components including meg-1, promotes the disassembly of zygotic P granules in the anterior cytoplasm during zygote polarization, and thus plays a role in P granule distribution and segregation in early stage embryos following meiosis (PubMed:25535836).
Functions in both spindle positioning and in the posterior localization of cytoplasmic determinants, including pie-1, pos-1, and pgl-1, in early embryos (PubMed:14697358).
Involved in the asymmetric distribution of plk-1 at the 2-cell embryonic stage (PubMed:18199581).
Through phosphorylation of P granule components including meg-1, promotes the disassembly of zygotic P granules in the anterior cytoplasm during zygote polarization, and thus plays a role in P granule distribution and segregation in early stage embryos following meiosis (PubMed:25535836).
Functions in both spindle positioning and in the posterior localization of cytoplasmic determinants, including pie-1, pos-1, and pgl-1, in early embryos (PubMed:14697358).
Involved in the asymmetric distribution of plk-1 at the 2-cell embryonic stage (PubMed:18199581).
Catalytic activity
- ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein]
Cofactor
Activity regulation
Activated during oocyte maturation by phosphorylation on Ser-362 by cdk-1. The pseudotyrosine phosphatases egg-4 and egg-5 sequester activated mbk-2 until the meiotic divisions and inhibit mbk-2 kinase activity directly, using a mixed-inhibition mechanism that does not involve tyrosine dephosphorylation.
Kinetics
KM | SUBSTRATE | pH | TEMPERATURE[C] | NOTES | EVIDENCE | |
---|---|---|---|---|---|---|
0.3 μM | mei-1 (Isoform a) |
The presence of egg-4 in the assay increases the KM of mbk-2 for mei-1.
Features
Showing features for binding site, active site.
GO annotations
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDual specificity tyrosine-phosphorylation-regulated kinase mbk-2
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ9XTF3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Maintained at the cortex by the cortical anchor egg-3 before meiotic divisions. During anaphase of meiosis I, egg-3 translocates into the cytoplasm on vesicles and is slowly degraded, releasing mbk-2.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Maternal-effect embryonic lethality due to defects in spindle positioning and cytokinesis in the early embryo (PubMed:12618396, PubMed:14697358).
Microtubules are fragmented and disordered (PubMed:14697358).
Abolishes phosphorylation of RNA-binding protein oma-1 in embryos (PubMed:16289132).
RNAi-mediated knockdown causes an increase in taf-4 nuclear localization in the one-cell embryo (PubMed:18854162).
RNAi-mediated knockdown causes a loss in plk-1 asymmetric localization in 2-cell stage embryo without affecting mex-5 polarization (PubMed:18199581).
RNAi-mediated knockdown disrupts P granule distribution in zygotes after meiosis whereby zygotic P granules fail to disassemble in the anterior cytoplasm during zygote polarization, however new P granules assemble and accumulate in the posterior cytoplasm as in wild-type (PubMed:25535836).
Microtubules are fragmented and disordered (PubMed:14697358).
Abolishes phosphorylation of RNA-binding protein oma-1 in embryos (PubMed:16289132).
RNAi-mediated knockdown causes an increase in taf-4 nuclear localization in the one-cell embryo (PubMed:18854162).
RNAi-mediated knockdown causes a loss in plk-1 asymmetric localization in 2-cell stage embryo without affecting mex-5 polarization (PubMed:18199581).
RNAi-mediated knockdown disrupts P granule distribution in zygotes after meiosis whereby zygotic P granules fail to disassemble in the anterior cytoplasm during zygote polarization, however new P granules assemble and accumulate in the posterior cytoplasm as in wild-type (PubMed:25535836).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 362 | Loss of phosphorylation by cdk-1. Loss of kinase activity. | ||||
Sequence: S → A | ||||||
Mutagenesis | 362 | Constitutively active. | ||||
Sequence: S → E | ||||||
Mutagenesis | 490 | Loss of autophosphorylation activity. Slight loss of binding to egg-4 and egg-5. | ||||
Sequence: K → R | ||||||
Mutagenesis | 619 | Reduced binding to egg-4 and egg-5 and translocation to the cytoplasm; when associated with F-621. | ||||
Sequence: Y → F | ||||||
Mutagenesis | 621 | Loss of tyrosine phosphorylation. Reduced binding to egg-4 and egg-5 and translocation to the cytoplasm; when associated with F-619. | ||||
Sequence: Y → F | ||||||
Mutagenesis | 764 | No loss of phosphorylation by cdk-1. | ||||
Sequence: T → A |
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000390717 | 1-817 | Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 | |||
Sequence: MAALASFTRNSRSYGQQPIDVTQQGQRDRSVMSLDAQGRSVSHECPTSTTLVRQLYLPQIPQSASFAAAPTSFSGASSSSSNHHHPVYHSQNSLPPNLLGSSQNSASSNSLVQGHRNPALGSGNTLTRSYHQPSSTNSSTNNLYGPLGTISRDLKQSIRDISPPVINSSANPHLVNYVQTSSFDNGSYEFPSGQAQQQRRLGGSQQHLAPLQQTASSLYSNPQSSSSQLLGQQQAVRPNYAYQQSLPRQQHINSHQTQAFFGTVRGPTNSTNIVTPLRASKTMIDVLAPVRDTVAAQATGLPNVGTSSSNGSSNSSSGVGSGGSGSLMTQSIGGPNKHLSASHSTLNTASTHDMMHSKIPKSPSNESLSRSHTSSSGGSQGGHNSNSGSNSGFRPEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLRRRLPNPPRDGLESMGGLADHEKKTETLPNIDSNANILMRKKF | ||||||
Modified residue | 362 | Phosphoserine; by cdk-1 | ||||
Sequence: S | ||||||
Modified residue | 621 | Phosphotyrosine; by autocatalysis | ||||
Sequence: Y |
Post-translational modification
Autophosphorylated.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
In L1 larvae, expressed widely in the nervous system, including head neurons and the ventral nerve cord. In adult animals, continues to be expressed in the nervous system and is also expressed in body wall muscle.
Developmental stage
Expressed both maternally and zygotically.
Gene expression databases
Interaction
Subunit
Part of a complex, consisting of pseudophosphatases egg-3, egg-4, egg-5 and kinase mbk-2; this complex is required for the oocyte-to-zygote transition (PubMed:19879842).
Interacts (via Tyr-619 and Tyr-621) with egg-4 (via tyrosine-protein phosphatase domain) and egg-5 (via tyrosine-protein phosphatase domain); mbk-2 tyrosine phosphorylation enhances the interaction (PubMed:19879842).
The interaction inhibits mbk-2 kinase activity and is required for mbk-2 oocyte cortex localization. Interacts (via N-terminus) with egg-3 (via tyrosine-protein phosphatase domain); the interaction does not affect mbk-2 kinase activity, is enhanced by mbk-2 tyrosine phosphorylation status and requires prior binding of mbk-2 to egg-4 and egg-5 (PubMed:17869113, PubMed:19879842).
Interacts (via Tyr-619 and Tyr-621) with egg-4 (via tyrosine-protein phosphatase domain) and egg-5 (via tyrosine-protein phosphatase domain); mbk-2 tyrosine phosphorylation enhances the interaction (PubMed:19879842).
The interaction inhibits mbk-2 kinase activity and is required for mbk-2 oocyte cortex localization. Interacts (via N-terminus) with egg-3 (via tyrosine-protein phosphatase domain); the interaction does not affect mbk-2 kinase activity, is enhanced by mbk-2 tyrosine phosphorylation status and requires prior binding of mbk-2 to egg-4 and egg-5 (PubMed:17869113, PubMed:19879842).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9XTF3 | egg-3 Q20402 | 9 | EBI-2005616, EBI-2476895 | |
BINARY | Q9XTF3-2 | mei-1 P34808 | 2 | EBI-2565597, EBI-323248 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-46 | Disordered | ||||
Sequence: MAALASFTRNSRSYGQQPIDVTQQGQRDRSVMSLDAQGRSVSHECP | ||||||
Compositional bias | 70-147 | Polar residues | ||||
Sequence: PTSFSGASSSSSNHHHPVYHSQNSLPPNLLGSSQNSASSNSLVQGHRNPALGSGNTLTRSYHQPSSTNSSTNNLYGPL | ||||||
Region | 70-148 | Disordered | ||||
Sequence: PTSFSGASSSSSNHHHPVYHSQNSLPPNLLGSSQNSASSNSLVQGHRNPALGSGNTLTRSYHQPSSTNSSTNNLYGPLG | ||||||
Region | 186-206 | Disordered | ||||
Sequence: GSYEFPSGQAQQQRRLGGSQQ | ||||||
Region | 301-396 | Disordered | ||||
Sequence: LPNVGTSSSNGSSNSSSGVGSGGSGSLMTQSIGGPNKHLSASHSTLNTASTHDMMHSKIPKSPSNESLSRSHTSSSGGSQGGHNSNSGSNSGFRPE | ||||||
Domain | 461-774 | Protein kinase | ||||
Sequence: YEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWL |
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 8 isoforms produced by Alternative splicing.
Q9XTF3-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Nameb
- Length817
- Mass (Da)89,885
- Last updated1999-11-01 v1
- Checksum74903C85CB68C428
Q9XTF3-2
- Namea
Q9XTF3-3
- Namec
- Differences from canonical
- 797-817: Missing
Q9XTF3-4
- Named
Q9XTF3-5
- Namee
Q9XTF3-6
- Namef
Q9XTF3-7
- Nameg
- Differences from canonical
- 148-164: Missing
Q9XTF3-8
- Nameh
- Differences from canonical
- 1-282: Missing
Computationally mapped potential isoform sequences
There are 6 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A061AKR6 | A0A061AKR6_CAEEL | mbk-2 | 779 | ||
A0A061AJ20 | A0A061AJ20_CAEEL | mbk-2 | 469 | ||
A0A061ADU8 | A0A061ADU8_CAEEL | mbk-2 | 490 | ||
A0A061ACK4 | A0A061ACK4_CAEEL | mbk-2 | 502 | ||
A0A061ACN3 | A0A061ACN3_CAEEL | mbk-2 | 523 | ||
A0A061ACN7 | A0A061ACN7_CAEEL | mbk-2 | 514 |
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_053626 | 1-282 | in isoform h | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_053183 | 1-294 | in isoform a | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_053625 | 1-297 | in isoform f | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_053182 | 1-301 | in isoform e | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_053181 | 1-327 | in isoform d | |||
Sequence: Missing | ||||||
Compositional bias | 70-147 | Polar residues | ||||
Sequence: PTSFSGASSSSSNHHHPVYHSQNSLPPNLLGSSQNSASSNSLVQGHRNPALGSGNTLTRSYHQPSSTNSSTNNLYGPL | ||||||
Alternative sequence | VSP_053627 | 148-164 | in isoform g | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_053184 | 295-310 | in isoform a | |||
Sequence: AAQATGLPNVGTSSSN → MTLFEPSTSGNRMGYR | ||||||
Alternative sequence | VSP_053628 | 298-310 | in isoform f | |||
Sequence: ATGLPNVGTSSSN → MFAIPFHRFYSDE | ||||||
Alternative sequence | VSP_053185 | 302-310 | in isoform e | |||
Sequence: PNVGTSSSN → MYSSLFELR | ||||||
Alternative sequence | VSP_053629 | 797-802 | in isoform f | |||
Sequence: KKTETL → VCFIIF | ||||||
Alternative sequence | VSP_053186 | 797-817 | in isoform a, isoform d and isoform e | |||
Sequence: KKTETLPNIDSNANILMRKKF → VCFIIF | ||||||
Alternative sequence | VSP_053187 | 797-817 | in isoform c | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_053630 | 803-817 | in isoform f | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY090019 EMBL· GenBank· DDBJ | AAM09088.1 EMBL· GenBank· DDBJ | mRNA | ||
Z70308 EMBL· GenBank· DDBJ | CAA94352.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z70308 EMBL· GenBank· DDBJ | CAA94353.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z81121 EMBL· GenBank· DDBJ | CAA94353.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z81146 EMBL· GenBank· DDBJ | CAA94353.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z70308 EMBL· GenBank· DDBJ | CAB54254.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z81121 EMBL· GenBank· DDBJ | CAB54254.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z81146 EMBL· GenBank· DDBJ | CAB54254.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z70308 EMBL· GenBank· DDBJ | CAJ76942.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z70308 EMBL· GenBank· DDBJ | CAJ80814.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z81121 EMBL· GenBank· DDBJ | CAJ80814.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z70308 EMBL· GenBank· DDBJ | CCG28133.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z81121 EMBL· GenBank· DDBJ | CCG28133.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z81146 EMBL· GenBank· DDBJ | CCG28133.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z70308 EMBL· GenBank· DDBJ | CCG28134.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z81121 EMBL· GenBank· DDBJ | CCG28134.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z70308 EMBL· GenBank· DDBJ | CCM09396.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z81121 EMBL· GenBank· DDBJ | CCM09396.1 EMBL· GenBank· DDBJ | Genomic DNA |