Q9XI99 · USPL1_ARATH
- ProteinBURP domain protein USPL1
- GeneUSPL1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids280 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Associated with the protein storage vacuole formation.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Golgi stack | |
Cellular Component | protein storage vacuole | |
Biological Process | seed development |
Names & Taxonomy
Protein names
- Recommended nameBURP domain protein USPL1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9XI99
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
No visible effect on seed development, but significant reduction of 11S seed storage protein content in the mature seeds (PubMed:19639386).
Enhanced drought tolerance (PubMed:25333723).
Enhanced drought tolerance (PubMed:25333723).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 20 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-24 | |||||
Sequence: MASTFRLSISFLTLILFSLWVVEA | ||||||
Chain | PRO_5005944492 | 25-280 | BURP domain protein USPL1 | |||
Sequence: HTSRKLISIKEKEGQDISHLLKDGEFDDPSLYMYFTLNDLKLGTKLLIYFYKNDLQKLPPLLTRQQADLIPFTKSKLDFLLDHFSITKDSPQGKAIKETLGHCDAKAIEGEHKFCGTSLESLIDLVKKTMGYNVDLKVMTTKVMVPAQNSISYALHNYTFVEAPKELVGIKMLGCHRMPYPYAVYYCHGHKGGSRVFEVNLVTDDGRQRVVGPAVCHMDTSTWDADHVAFKVLKMEPRSAPVCHFFPLDNIVWVTK |
Proteomic databases
Expression
Tissue specificity
Expressed in cotyledons, radicle, floral buds, open flowers, roots and developing seeds, but not in leaves (PubMed:19714473).
Highly expressed in the root tips. Detected in young leaves, hypocotyls, stems and mature seed funiculum (PubMed:25333723).
Highly expressed in the root tips. Detected in young leaves, hypocotyls, stems and mature seed funiculum (PubMed:25333723).
Induction
Up-regulated in the root by dehydration, salt stress, osmotic stress, high temperature and abscisic acid.
Developmental stage
Expressed in embryos at the cotyledon stage.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 58-280 | BURP | ||||
Sequence: YFTLNDLKLGTKLLIYFYKNDLQKLPPLLTRQQADLIPFTKSKLDFLLDHFSITKDSPQGKAIKETLGHCDAKAIEGEHKFCGTSLESLIDLVKKTMGYNVDLKVMTTKVMVPAQNSISYALHNYTFVEAPKELVGIKMLGCHRMPYPYAVYYCHGHKGGSRVFEVNLVTDDGRQRVVGPAVCHMDTSTWDADHVAFKVLKMEPRSAPVCHFFPLDNIVWVTK |
Domain
The BURP domain located at the C-terminus has not been identified in non-plant proteins.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length280
- Mass (Da)31,811
- Last updated1999-11-01 v1
- Checksum04EC3EA19608D29C
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC007504 EMBL· GenBank· DDBJ | AAD43166.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE32417.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT006428 EMBL· GenBank· DDBJ | AAP21236.1 EMBL· GenBank· DDBJ | mRNA | ||
AK227709 EMBL· GenBank· DDBJ | BAE99695.1 EMBL· GenBank· DDBJ | mRNA |