Q9XI73 · PNSL2_ARATH
- ProteinPhotosynthetic NDH subunit of lumenal location 2, chloroplastic
- GenePNSL2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids190 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (Probable). Required for both formation and activity of the chloroplast NAD(P)H dehydrogenase (NDH) complex (PubMed:20430763, PubMed:20460499).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | chloroplast thylakoid | |
Cellular Component | chloroplast thylakoid lumen | |
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | extrinsic component of membrane | |
Cellular Component | nitrite reductase complex [NAD(P)H] | |
Cellular Component | photosystem II oxygen evolving complex | |
Molecular Function | calcium ion binding | |
Molecular Function | electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity | |
Biological Process | photosynthetic electron transport chain |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended namePhotosynthetic NDH subunit of lumenal location 2, chloroplastic
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9XI73
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Plastid, chloroplast thylakoid membrane ; Peripheral membrane protein
Note: Associated with the chloroplast NAD(P)H dehydrogenase/photosystem I (NDH/PSI) supercomplex.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Impaired chloroplastic NAD(P)H dehydrogenase (NDH) activity leading to the loss of post-illumination increases in Chl fluorescence, probably due to a reduced stability of the NDH complex.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 16 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-31 | Chloroplast | ||||
Sequence: MSSFTTTNTPPPYLLRKIYHRRVNQPFSVVC | ||||||
Transit peptide | 32-68 | Thylakoid | ||||
Sequence: CTGEPQQDIFTRRRTLTSLITFTVIGGATSSALAQEK | ||||||
Chain | PRO_0000419235 | 69-190 | Photosynthetic NDH subunit of lumenal location 2, chloroplastic | |||
Sequence: WGTRSFIKEKYFMPGLSPEDAAARIKQTAEGLRDMREMLDHMSWRYVIFYIRLKQAYLSQDLTNAMNILPESRRNDYVQAANELVENMSELDFYVRTPKVYESYLYYEKTLKSIDNVVEFLA |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 87-107 | |||||
Sequence: EDAAARIKQTAEGLRDMREML | ||||||
Coiled coil | 139-159 | |||||
Sequence: ESRRNDYVQAANELVENMSEL |
Sequence similarities
Belongs to the PsbQ family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
Q9XI73-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length190
- Mass (Da)22,157
- Last updated1999-11-01 v1
- Checksum00050C5A816D1B06
Q9XI73-2
- Name2
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF083742 EMBL· GenBank· DDBJ | AAN60300.1 EMBL· GenBank· DDBJ | mRNA | ||
AC007576 EMBL· GenBank· DDBJ | AAD39297.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE29111.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE29112.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF370579 EMBL· GenBank· DDBJ | AAK49585.1 EMBL· GenBank· DDBJ | mRNA | ||
AY088325 EMBL· GenBank· DDBJ | AAM65864.1 EMBL· GenBank· DDBJ | mRNA | ||
AK229642 EMBL· GenBank· DDBJ | BAF01486.1 EMBL· GenBank· DDBJ | mRNA |