Q9XI31 · GLYI4_ARATH
- ProteinGlyoxylase I 4
- GeneGLYI4
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids174 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Involved in the detoxification and scavenging of methylglyoxal (MG), a cytotoxic aldehyde produced in response to primary metabolism alteration observed during biotic and abiotic stresses (PubMed:31652571).
Modulates cross-talk between salicylic acid (SA) and jasmonic acid (JA) signaling pathways during defense responses to pathogens such as Botrytis cinerea (PubMed:29852537).
Modulates cross-talk between salicylic acid (SA) and jasmonic acid (JA) signaling pathways during defense responses to pathogens such as Botrytis cinerea (PubMed:29852537).
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 131 | Proton donor/acceptor | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | plasma membrane | |
Molecular Function | lyase activity | |
Biological Process | cellular detoxification of methylglyoxal | |
Biological Process | defense response | |
Biological Process | regulation of abscisic acid-activated signaling pathway | |
Biological Process | regulation of jasmonic acid mediated signaling pathway | |
Biological Process | regulation of salicylic acid mediated signaling pathway | |
Biological Process | response to cold | |
Biological Process | response to heat | |
Biological Process | response to jasmonic acid | |
Biological Process | response to methylglyoxal | |
Biological Process | response to nickel cation | |
Biological Process | response to osmotic stress | |
Biological Process | response to oxidative stress | |
Biological Process | response to salt | |
Biological Process | response to UV-B | |
Biological Process | response to water deprivation | |
Biological Process | response to wounding |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameGlyoxylase I 4
- Short namesAtGLXI-like;4 ; AtGLYI4
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9XI31
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localized at the plasma membrane during methylglyoxal (MG) accumulation, but translocates to the cytoplasm upon jasmonate (MeJA) stimulus.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
General stress phenotype, characterized by compromised methylglyoxal (MG) scavenging, accumulation of reactive oxygen species (ROS), stomatal closure, and reduced fitness associated with reduced leaf area and dry weight, as well as prolonged flowering time (PubMed:31652571).
Increased susceptibility to the pathogenic fungus Plectospherella cucumerina which triggers mainly the jasmonate (JA)-mediated defense signaling pathway (PubMed:31652571).
Abnormal cross-talk between salicylic acid (SA) and jasmonic acid (JA) signaling pathways (PubMed:29852537).
Increased susceptibility to the pathogenic fungus Plectospherella cucumerina which triggers mainly the jasmonate (JA)-mediated defense signaling pathway (PubMed:31652571).
Abnormal cross-talk between salicylic acid (SA) and jasmonic acid (JA) signaling pathways (PubMed:29852537).
Variants

We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 6 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000453957 | 1-174 | Glyoxylase I 4 | |||
Sequence: MKEDAGNPLHLTSLNHVSVLCRSVDESMNFYQKVLGFIPIRRPESLNFEGAWLFGHGIGIHLLCAPEPEKLPKKTAINPKDNHISFQCESMGVVEKKLEEMGIDYVRALVEEGGIQVDQLFFHDPDGFMIEICNCDSLPVVPLVGEMARSCSRVKLHQMVQPQPQTQIHQVVYP |
Proteomic databases
Expression
Tissue specificity
Mostly expressed in roots, and, to a lower extent, in leaves, flowers, seeds and siliques.
Induction
Accumulates in response to abiotic stresses such as cold, heat, drought, oxidative stress, genotoxic compounds, wounding, osmotic stress and UV-B (PubMed:21213008).
Slightly induced by salt (NaCl) and nickel ions Ni2+ (PubMed:21213008, PubMed:30483284).
Strongly induced by methylglyoxal (MG) (PubMed:31652571).
Slightly induced by salt (NaCl) and nickel ions Ni2+ (PubMed:21213008, PubMed:30483284).
Strongly induced by methylglyoxal (MG) (PubMed:31652571).
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 13-135 | VOC | ||||
Sequence: SLNHVSVLCRSVDESMNFYQKVLGFIPIRRPESLNFEGAWLFGHGIGIHLLCAPEPEKLPKKTAINPKDNHISFQCESMGVVEKKLEEMGIDYVRALVEEGGIQVDQLFFHDPDGFMIEICNC |
Sequence similarities
Belongs to the glyoxalase I family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length174
- Mass (Da)19,594
- Last updated1999-11-01 v1
- Checksum078B0EEBE1801054
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC007591 EMBL· GenBank· DDBJ | AAD39666.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE29312.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE29313.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY072377 EMBL· GenBank· DDBJ | AAL62369.1 EMBL· GenBank· DDBJ | mRNA | ||
AY114619 EMBL· GenBank· DDBJ | AAM47938.1 EMBL· GenBank· DDBJ | mRNA | ||
AK317354 EMBL· GenBank· DDBJ | BAH20026.1 EMBL· GenBank· DDBJ | mRNA | ||
AY088300 EMBL· GenBank· DDBJ | AAM65839.1 EMBL· GenBank· DDBJ | mRNA |