Q9XE33 · NFYC6_ORYSJ
- ProteinNuclear transcription factor Y subunit C-6
- GeneNFYC6
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids205 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Component of the NF-Y/HAP transcription factor complex.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | protein heterodimerization activity | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameNuclear transcription factor Y subunit C-6
- Short namesOsNF-YC6
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ9XE33
Proteomes
Genome annotation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000437436 | 1-205 | Nuclear transcription factor Y subunit C-6 | |||
Sequence: MEPKSTTPPPPPPPPVLGAPVPYPPAGAYPPPVGPYAHAPPLYAPPPPAAAAASAAATAASQQAAAAQLQNFWAEQYREIEHTTDFKNHNLPLARIKKIMKADEDVRMIAAEAPVVFARACEMFILELTHRGWAHAEENKRRTLQKSDIAAAIARTEVFDFLVDIVPRDEAKDAEAAAAVAAGIPHPAAGLPATDPMAYYYVQPQ |
Proteomic databases
Interaction
Subunit
Heterotrimeric transcription factor composed of three components, NF-YA, NF-YB and NF-YC. NF-YB and NF-YC must interact and dimerize for NF-YA association and DNA binding (By similarity).
Interacts with NFYB2 (PubMed:18193457).
Interacts with NFYB8, NFYB10 and HD5/NFYB11 (PubMed:26542958).
Interacts with NFYB2 (PubMed:18193457).
Interacts with NFYB8, NFYB10 and HD5/NFYB11 (PubMed:26542958).
Protein-protein interaction databases
Structure
Family & Domains
Sequence
- Sequence statusComplete
- Length205
- Mass (Da)21,909
- Last updated1999-11-01 v1
- ChecksumF747D35F886B59C8
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB288044 EMBL· GenBank· DDBJ | BAF64452.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP000364 EMBL· GenBank· DDBJ | BAA81759.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP005148 EMBL· GenBank· DDBJ | BAD10129.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008214 EMBL· GenBank· DDBJ | BAF24050.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014964 EMBL· GenBank· DDBJ | BAT06066.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK108510 EMBL· GenBank· DDBJ | BAG98424.1 EMBL· GenBank· DDBJ | mRNA |