Q9WVF9 · CLC2I_MOUSE
- ProteinC-type lectin domain family 2 member I
- GeneClec2i
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids217 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Inhibits osteoclast formation. Receptor for KLRB1F. Enhances T-cell activation. Plays a role in splenocyte activation, T-cell responses and IL-2 production.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell surface | |
Cellular Component | external side of plasma membrane | |
Molecular Function | carbohydrate binding | |
Molecular Function | natural killer cell lectin-like receptor binding | |
Molecular Function | transmembrane signaling receptor activity | |
Biological Process | membrane raft assembly | |
Biological Process | negative regulation of osteoclast differentiation | |
Biological Process | positive regulation of immunological synapse formation | |
Biological Process | receptor clustering | |
Biological Process | regulation of actin filament polymerization | |
Biological Process | regulation of interleukin-2 production | |
Biological Process | regulation of T cell proliferation | |
Biological Process | T cell receptor signaling pathway |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Recommended nameC-type lectin domain family 2 member I
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9WVF9
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type II membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-53 | Cytoplasmic | ||||
Sequence: MPDCLETGEKLFVHNMNAQCVQKPEEGNGPLGTGGKIVQGKCFRIISTVSPVK | ||||||
Transmembrane | 54-74 | Helical; Signal-anchor for type II membrane protein | ||||
Sequence: LYCCYGVIMVLTVAVIALSVA | ||||||
Topological domain | 75-217 | Extracellular | ||||
Sequence: LSTKKTEQIIINKTYAACSKNWTGVGNKCFYFSGYPRNWTFAQAFCMAQEAQLARFDNEEELIFLKRFKGDFDCWIGLHRESSEHPWKWTNNTEYNNMNPILGVGRYAYLSSDRISSSRSYINRMWICSKLNNYNLHCQTPPV |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000315291 | 1-217 | C-type lectin domain family 2 member I | |||
Sequence: MPDCLETGEKLFVHNMNAQCVQKPEEGNGPLGTGGKIVQGKCFRIISTVSPVKLYCCYGVIMVLTVAVIALSVALSTKKTEQIIINKTYAACSKNWTGVGNKCFYFSGYPRNWTFAQAFCMAQEAQLARFDNEEELIFLKRFKGDFDCWIGLHRESSEHPWKWTNNTEYNNMNPILGVGRYAYLSSDRISSSRSYINRMWICSKLNNYNLHCQTPPV | ||||||
Disulfide bond | 92↔103 | |||||
Sequence: CSKNWTGVGNKC | ||||||
Glycosylation | 112 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 120↔202 | |||||
Sequence: CMAQEAQLARFDNEEELIFLKRFKGDFDCWIGLHRESSEHPWKWTNNTEYNNMNPILGVGRYAYLSSDRISSSRSYINRMWIC |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Detected in osteoblasts, growth plate chondrocytes and skeletal muscle overlying the bone (at protein level). Detected in spleen, B-cells, dendritic cells, thymus, and in IL2-activated natural killer cells.
Induction
Up-regulated in CD4+ T-cells upon stimulation with CD3-ligands. Up-regulated in cultured calvarial osteoblasts by 1,25-dihydroxyvitamin D3. Constitutively expressed in cultured bone marrow cells during osteoclast formation.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 99-203 | C-type lectin | ||||
Sequence: VGNKCFYFSGYPRNWTFAQAFCMAQEAQLARFDNEEELIFLKRFKGDFDCWIGLHRESSEHPWKWTNNTEYNNMNPILGVGRYAYLSSDRISSSRSYINRMWICS |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 4 isoforms produced by Alternative splicing.
Q9WVF9-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length217
- Mass (Da)24,671
- Last updated1999-11-01 v1
- Checksum28D497A39F05DCD8
Q9WVF9-2
- Name2
- SynonymsLymphoid-derived C-type lectin-1b, LCL-1b
- Differences from canonical
- 35-35: G → GVQCC
Q9WVF9-3
- Name3
- SynonymsLymphoid-derived C-type lectin-1a, LCL-1a
Q9WVF9-4
- Name4
- SynonymsLymphoid-derived C-type lectin-1c, LCL-1c
- Differences from canonical
- 1-61: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
E0CX52 | E0CX52_MOUSE | Clec2i | 246 |
Sequence caution
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF350411 EMBL· GenBank· DDBJ | AAK70359.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AY137343 EMBL· GenBank· DDBJ | AAN15951.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY137343 EMBL· GenBank· DDBJ | AAN15952.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY137344 EMBL· GenBank· DDBJ | AAN15953.1 EMBL· GenBank· DDBJ | mRNA | ||
AY137345 EMBL· GenBank· DDBJ | AAN15954.1 EMBL· GenBank· DDBJ | mRNA | ||
AY256574 EMBL· GenBank· DDBJ | AAP32744.1 EMBL· GenBank· DDBJ | mRNA | ||
AY256575 EMBL· GenBank· DDBJ | AAP32745.1 EMBL· GenBank· DDBJ | mRNA | ||
AY256576 EMBL· GenBank· DDBJ | AAP32746.1 EMBL· GenBank· DDBJ | mRNA | ||
AF121352 EMBL· GenBank· DDBJ | AAD22055.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ143112 EMBL· GenBank· DDBJ | ABA43362.1 EMBL· GenBank· DDBJ | Genomic DNA |