Q9WUH2 · LHX9_MOUSE
- ProteinLIM/homeobox protein Lhx9
- GeneLhx9
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids397 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in gonadal development.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 267-326 | Homeobox | ||||
Sequence: TKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNL |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | metal ion binding | |
Molecular Function | RNA polymerase II transcription regulatory region sequence-specific DNA binding | |
Biological Process | cell population proliferation | |
Biological Process | dorsal spinal cord interneuron anterior axon guidance | |
Biological Process | female gonad development | |
Biological Process | gonad morphogenesis | |
Biological Process | male gonad development | |
Biological Process | negative regulation of DNA-templated transcription | |
Biological Process | neuron differentiation | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Recommended nameLIM/homeobox protein Lhx9
- Short namesLIM homeobox protein 9
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9WUH2
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000075799 | 1-397 | LIM/homeobox protein Lhx9 | |||
Sequence: MEIVGCRAENNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLTKGTQLNGRDAGMPPLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDIVNYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPTVTVVTTVTSNMDSHEPGSPSQTTLTNLF |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the dorsal thalamus and inner nuclei of the cerebellum.
Developmental stage
Expressed in urogenital ridges of mice at 9.5 dpc. Expressed in the nervous system at 10.5 dpc. Expressed in the forelimb and hindlimb buds, the caelomic cavity at the level of the urogenital ridge, including the gonads, the pancreas and liver epithelium at 11.5 dpc. Expressed widespread throughout the CNS alar neuroepithelium from 11.5 to 14.5 dpc. Expressed in pioneer neurons of the cerebral cortex. In the telencephalic vesicles, expressed in cerebral cortex, the hippocampus, the claustrum primordium, olfactory bulb primordium and the caudal ganglionic eminence (amygdaloid complex) at 13.5 dpc. In the diencephalon, expressed in the pretectum (p1 prosomere), the dorsal thalamus (except for a thin ventral band close to the alar-basal boundary), the epithalamus, the epiphysis in prosomere p2, the supraoptic-paraventricular area, the eminentia thalami (p4 prosomere), the retrochiasmatic area and the tuberal hypothalamus at 13.5 dpc. In the mesencephalon, expressed in the tectum, the walls of the hindbrain, in nuclei of the ventral midbrain and hindbrain at 13.5 dpc. In the spinal cord, expressed as a gradient in the dorsal part of the neuroepithelium at 13.5 dpc. In the neocortical neuroepithelium, expressed in the archicortex (in the dentate gyrus, CA3 and CA4), the diencephalon, the midbrain and hindbrain at 14.5 and 16.5 dpc.
Gene expression databases
Interaction
Subunit
Interacts with LDB1 and LDB2.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9WUH2 | Ssbp2 Q9CYZ8 | 3 | EBI-309943, EBI-309962 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 69-130 | LIM zinc-binding 1 | ||||
Sequence: ALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSV | ||||||
Domain | 131-193 | LIM zinc-binding 2 | ||||
Sequence: QRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQG | ||||||
Region | 248-272 | Disordered | ||||
Sequence: ENEADHLDRDQQPYPPSQKTKRMRT | ||||||
Region | 330-365 | Disordered | ||||
Sequence: ENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDL | ||||||
Region | 378-397 | Disordered | ||||
Sequence: SNMDSHEPGSPSQTTLTNLF |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 4 isoforms produced by Alternative splicing.
Q9WUH2-3
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name3
- Length397
- Mass (Da)44,045
- Last updated2009-03-03 v3
- Checksum4E2DCF65B5EDFC54
Q9WUH2-1
- Name1
- SynonymsBeta
- Differences from canonical
- 1-18: MEIVGCRAENNSCPFRPP → MLNGTTLEA
Q9WUH2-2
- Name2
- SynonymsAlpha
Q9WUH2-4
- Name4
- Differences from canonical
- 313-397: VWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPTVTVVTTVTSNMDSHEPGSPSQTTLTNLF → GEQILGHYSQTSRRLKIP
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0A6YY42 | A0A0A6YY42_MOUSE | Lhx9 | 75 |
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_036430 | 1-18 | in isoform 1 and isoform 2 | |||
Sequence: MEIVGCRAENNSCPFRPP → MLNGTTLEA | ||||||
Sequence conflict | 58 | in Ref. 5; AAD22008 | ||||
Sequence: A → T | ||||||
Sequence conflict | 162 | in Ref. 5; AAD22008 | ||||
Sequence: S → F | ||||||
Alternative sequence | VSP_036431 | 313-397 | in isoform 2 and isoform 4 | |||
Sequence: VWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPTVTVVTTVTSNMDSHEPGSPSQTTLTNLF → GEQILGHYSQTSRRLKIP | ||||||
Sequence conflict | 377 | in Ref. 1; CAB59908 and 5; AAD22008 | ||||
Sequence: T → I |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ243851 EMBL· GenBank· DDBJ | CAB59907.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ243852 EMBL· GenBank· DDBJ | CAB59908.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ243853 EMBL· GenBank· DDBJ | CAB59908.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ243854 EMBL· GenBank· DDBJ | CAB59908.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ243855 EMBL· GenBank· DDBJ | CAB59908.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ243856 EMBL· GenBank· DDBJ | CAB59908.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ243852 EMBL· GenBank· DDBJ | CAB59909.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ243853 EMBL· GenBank· DDBJ | CAB59909.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ243854 EMBL· GenBank· DDBJ | CAB59909.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ243855 EMBL· GenBank· DDBJ | CAB59909.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ243857 EMBL· GenBank· DDBJ | CAB59909.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC154398 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC072623 EMBL· GenBank· DDBJ | AAH72623.1 EMBL· GenBank· DDBJ | mRNA | ||
AF134761 EMBL· GenBank· DDBJ | AAD30110.1 EMBL· GenBank· DDBJ | mRNA | ||
AF113518 EMBL· GenBank· DDBJ | AAD22008.1 EMBL· GenBank· DDBJ | mRNA |