Q9WUB5 · NCOR1_RAT
- ProteinNuclear receptor corepressor 1
- GeneNcor1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids533 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Mediates transcriptional repression by certain nuclear receptors. Part of a complex which promotes histone deacetylation and the formation of repressive chromatin structures which may impede the access of basal transcription factors. Participates in the transcriptional repressor activity produced by BCL6. Recruited by ZBTB7A to the androgen response elements/ARE on target genes, negatively regulates androgen receptor signaling and androgen-induced cell proliferation (By similarity).
Mediates the NR1D1-dependent repression and circadian regulation of TSHB expression (By similarity).
The NCOR1-HDAC3 complex regulates the circadian expression of the core clock gene ARTNL/BMAL1 and the genes involved in lipid metabolism in the liver (By similarity).
Mediates the NR1D1-dependent repression and circadian regulation of TSHB expression (By similarity).
The NCOR1-HDAC3 complex regulates the circadian expression of the core clock gene ARTNL/BMAL1 and the genes involved in lipid metabolism in the liver (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameNuclear receptor corepressor 1
- Short namesN-CoR; N-CoR1
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ9WUB5
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000055619 | 1-533 | Nuclear receptor corepressor 1 | |||
Sequence: KDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYEAPSDAIEVISPASSPAPPQEKPQTYQPEMVKANQAENESPQQYEGPLTHYRSQQGSPSPQQQPPLPPSSQAEGMGQVPRTHRLITLADHICQIITQDFARNQVPSQPSTSTFQTSPSALSSTPVRTKPSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGSRPGKSPERSHIPSEPYEPISPPQGPAVHEKQDSMLLLSQRGMDPAEQRSDSRSPGSISYLPYFFTKLESTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGAVSSRSHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMPHPVGVVPGSASTSVVTSSETRRDEGDPSPHSGVCKPKLINKSNSRKSKSPIPGQNYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTIRMLSSTPPTPIACAPSAITQAAPHQQSRIWEREPAPLLSAQYETLSDSDD | ||||||
Modified residue | 73 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 77 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 196 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 214 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 230 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 245 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 278 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 492 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 529 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 531 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Ubiquitinated; mediated by SIAH2 and leading to its subsequent proteasomal degradation.
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Forms a large corepressor complex that contains SIN3A/B and histone deacetylases HDAC1 and HDAC2. This complex associates with the thyroid receptor (TR) and the retinoid acid receptor (RAR) in the absence of ligand. Interacts directly with RARA; the interaction is facilitated with RARA trimethylation. Component of the N-Cor repressor complex, at least composed of CBFA2T3, HEXIM1, NCOR1, NCOR2, HDAC3, TBL1X, TBL1XR1, CORO2A and GPS2. Interacts with ZBTB33; the interaction serves to recruit the N-CoR complex to promoter regions containing methylated CpG dinucleotides. Interacts with TRIM28 and KDM3A. Interacts (via the RD1 domain) with BAZ1A (via its N-terminal); the interaction corepresses a number of NCOR1-regulated genes. Interacts with BCL6, C1D, DACH1, HEXIM1, HDAC7, RORA, RORC, SAP30, SIAH2, SIN3A and SIN3B. May interact with DEAF1. Interacts with RXRA. Interacts with SETD5. Interacts with VDR. Interacts with ZBTB7A (By similarity).
Interacts with AR (By similarity).
Interacts with HDAC3 (By similarity).
Interacts with AR (By similarity).
Interacts with HDAC3 (By similarity).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-19 | Basic and acidic residues | ||||
Sequence: KDKGPPPKSRYEEELRTRG | ||||||
Region | 1-21 | Disordered | ||||
Sequence: KDKGPPPKSRYEEELRTRGKT | ||||||
Motif | 29-33 | CORNR box 1 | ||||
Sequence: IDVII | ||||||
Region | 37-144 | Disordered | ||||
Sequence: IASDKDARERGSQSSDSSSSLSSHRYEAPSDAIEVISPASSPAPPQEKPQTYQPEMVKANQAENESPQQYEGPLTHYRSQQGSPSPQQQPPLPPSSQAEGMGQVPRTH | ||||||
Compositional bias | 89-121 | Polar residues | ||||
Sequence: QPEMVKANQAENESPQQYEGPLTHYRSQQGSPS | ||||||
Region | 130-209 | ID1 | ||||
Sequence: PSSQAEGMGQVPRTHRLITLADHICQIITQDFARNQVPSQPSTSTFQTSPSALSSTPVRTKPSSRYSPESQSQTVLHPRP | ||||||
Region | 145-148 | Required for interaction with RARA in the absence of its ligand | ||||
Sequence: RLIT | ||||||
Motif | 153-157 | CORNR box 2 | ||||
Sequence: ICQII | ||||||
Compositional bias | 165-207 | Polar residues | ||||
Sequence: QVPSQPSTSTFQTSPSALSSTPVRTKPSSRYSPESQSQTVLHP | ||||||
Region | 165-254 | Disordered | ||||
Sequence: QVPSQPSTSTFQTSPSALSSTPVRTKPSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGSRPGKSPERSHIPSEPYEPISPPQGPAVHE | ||||||
Compositional bias | 222-236 | Basic and acidic residues | ||||
Sequence: SRGSRPGKSPERSHI | ||||||
Region | 306-367 | ID2 | ||||
Sequence: IFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGAVSSRSHSFADPASNLGLEDIIRKALMG | ||||||
Motif | 357-361 | CORNR box 3 | ||||
Sequence: LEDII | ||||||
Region | 382-476 | Disordered | ||||
Sequence: HPVGVVPGSASTSVVTSSETRRDEGDPSPHSGVCKPKLINKSNSRKSKSPIPGQNYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQF | ||||||
Compositional bias | 418-454 | Polar residues | ||||
Sequence: KLINKSNSRKSKSPIPGQNYLGTERPSSVSSVHSEGD |
Domain
The N-terminal region contains three independent domains that are capable of mediating transcriptional repression (RD1, RD2 and RD3).
The C-terminal region contains two separate nuclear receptor-interacting domains (ID1 and ID2), each of which contains a conserved sequence referred to as the CORNR box. This motif is necessary and sufficient for binding to unligated nuclear hormone receptors, while sequences flanking the CORNR box determine the precise nuclear hormone receptor specificity (By similarity).
Sequence similarities
Belongs to the N-CoR nuclear receptor corepressors family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusFragment
- Length533
- Mass (Da)57,795
- Last updated1999-11-01 v1
- Checksum7DF60F8228227EC2
Computationally mapped potential isoform sequences
There are 7 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0G2K2B4 | A0A0G2K2B4_RAT | Ncor1 | 2414 | ||
A0A8I6AMG4 | A0A8I6AMG4_RAT | Ncor1 | 2544 | ||
A0A8I6ALG2 | A0A8I6ALG2_RAT | Ncor1 | 2420 | ||
A0A8I6APG3 | A0A8I6APG3_RAT | Ncor1 | 2474 | ||
A0A8I5ZYC0 | A0A8I5ZYC0_RAT | Ncor1 | 291 | ||
A0A8I5Y9M5 | A0A8I5Y9M5_RAT | Ncor1 | 2532 | ||
A0A8I5ZV51 | A0A8I5ZV51_RAT | Ncor1 | 2376 |
Features
Showing features for non-terminal residue, compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: K | ||||||
Compositional bias | 1-19 | Basic and acidic residues | ||||
Sequence: KDKGPPPKSRYEEELRTRG | ||||||
Compositional bias | 89-121 | Polar residues | ||||
Sequence: QPEMVKANQAENESPQQYEGPLTHYRSQQGSPS | ||||||
Compositional bias | 165-207 | Polar residues | ||||
Sequence: QVPSQPSTSTFQTSPSALSSTPVRTKPSSRYSPESQSQTVLHP | ||||||
Compositional bias | 222-236 | Basic and acidic residues | ||||
Sequence: SRGSRPGKSPERSHI | ||||||
Compositional bias | 418-454 | Polar residues | ||||
Sequence: KLINKSNSRKSKSPIPGQNYLGTERPSSVSSVHSEGD | ||||||
Sequence conflict | 484 | in Ref. 2; AAC14567 | ||||
Sequence: R → W | ||||||
Sequence conflict | 497 | in Ref. 2; AAC14567 | ||||
Sequence: A → V |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF124821 EMBL· GenBank· DDBJ | AAD32566.1 EMBL· GenBank· DDBJ | mRNA | ||
AF059311 EMBL· GenBank· DDBJ | AAC14567.1 EMBL· GenBank· DDBJ | mRNA |