Q9WTV7 · RNF12_MOUSE
- ProteinE3 ubiquitin-protein ligase RLIM
- GeneRlim
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids600 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
E3 ubiquitin-protein ligase that acts as a negative coregulator for LIM homeodomain transcription factors by mediating the ubiquitination and subsequent degradation of LIM cofactors LDB1 and LDB2 and by mediating the recruitment the SIN3a/histone deacetylase corepressor complex. Ubiquitination and degradation of LIM cofactors LDB1 and LDB2 allows DNA-bound LIM homeodomain transcription factors to interact with other protein partners such as RLIM. Plays a role in telomere length-mediated growth suppression by mediating the ubiquitination and degradation of TERF1. By targeting ZFP42 for degradation, acts as an activator of random inactivation of X chromosome in the embryo, a stochastic process in which one X chromosome is inactivated to minimize sex-related dosage differences of X-encoded genes in somatic cells of female placental mammals.
Catalytic activity
Pathway
Protein modification; protein ubiquitination.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Molecular Function | metal ion binding | |
Molecular Function | ubiquitin protein ligase activity | |
Molecular Function | ubiquitin-protein transferase activity | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | protein ubiquitination | |
Biological Process | random inactivation of X chromosome | |
Biological Process | ubiquitin-dependent protein catabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameE3 ubiquitin-protein ligase RLIM
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9WTV7
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Modified residue | 1 | N-acetylmethionine | ||||
Sequence: M | ||||||
Chain | PRO_0000056053 | 1-600 | E3 ubiquitin-protein ligase RLIM | |||
Sequence: MENSDSNDKGSDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQSPDENRAGESSDDVTNSDSIIDWLNSVRQTGNTTRSGQRGNQSWRAVSRTNPNSGDFRFSLEINVNRNNGSQTSENESEPSTRRLSVENMESSSQRQMENSASESASARPSRAERNSAEAVTEVPTTRAQRRARSRSPEHRRTRARAERSRSPLQPTSEIPRRAPTLEQSSENEPEGSSRTRHHVTLRQQISGPELLGRGLFAASGSRNPSQGTSSSDTGSNSESSGSGQRPPTIVLDLQVRRVRPGEYRQRDSIASRTRSRSQAPNNTVTYESERGGFRRTFSRSERAGVRTYVSTIRIPIRRILNTGLSETTSVAIQTMLRQIMTGFGELSYFMYSDSDSEPSASVSSRNVERVESRNGRGSSGGGNSSGSSSSSSPSPSSSGESSESSSEMFEGSSEGGSSGPSRRDGRHRAPVTFDESGSLPFLSLAQFFLLNEDDEDQPRGLTKEQIDNLAMRSFGENDALKTCSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLSSGNRESVV | ||||||
Modified residue | 163 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 194 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 227 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 229 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 269 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Induction
Expressed at higher level in female compared to males cells (at protein level).
Developmental stage
Ubiquitously expressed in early development. Expressed in the time window of embryonic stem (ES) cell differentiation.
Gene expression databases
Interaction
Subunit
Interacts (via N-terminus) with TERF1. Interacts (via C-terminus) with ESR1 (By similarity).
Interacts with LIM/homeobox factors such as LHX3. Interacts with LDB1, LDB2 and SIN3A. Interacts with LIMK1
Interacts with LIM/homeobox factors such as LHX3. Interacts with LDB1, LDB2 and SIN3A. Interacts with LIMK1
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9WTV7 | Ldb2 O55203 | 2 | EBI-15657872, EBI-15657830 | |
BINARY | Q9WTV7 | Zfp42 P22227 | 8 | EBI-15657872, EBI-2313372 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, zinc finger, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-24 | Disordered | ||||
Sequence: MENSDSNDKGSDQSAAQRRSQMDR | ||||||
Region | 49-355 | Disordered | ||||
Sequence: NNLLGTPGESTEEELLRRLQQIKEGPPPQSPDENRAGESSDDVTNSDSIIDWLNSVRQTGNTTRSGQRGNQSWRAVSRTNPNSGDFRFSLEINVNRNNGSQTSENESEPSTRRLSVENMESSSQRQMENSASESASARPSRAERNSAEAVTEVPTTRAQRRARSRSPEHRRTRARAERSRSPLQPTSEIPRRAPTLEQSSENEPEGSSRTRHHVTLRQQISGPELLGRGLFAASGSRNPSQGTSSSDTGSNSESSGSGQRPPTIVLDLQVRRVRPGEYRQRDSIASRTRSRSQAPNNTVTYESERGG | ||||||
Compositional bias | 89-189 | Polar residues | ||||
Sequence: DDVTNSDSIIDWLNSVRQTGNTTRSGQRGNQSWRAVSRTNPNSGDFRFSLEINVNRNNGSQTSENESEPSTRRLSVENMESSSQRQMENSASESASARPSR | ||||||
Compositional bias | 227-251 | Polar residues | ||||
Sequence: SRSPLQPTSEIPRRAPTLEQSSENE | ||||||
Compositional bias | 282-310 | Polar residues | ||||
Sequence: SGSRNPSQGTSSSDTGSNSESSGSGQRPP | ||||||
Compositional bias | 320-334 | Basic and acidic residues | ||||
Sequence: RVRPGEYRQRDSIAS | ||||||
Compositional bias | 335-352 | Polar residues | ||||
Sequence: RTRSRSQAPNNTVTYESE | ||||||
Compositional bias | 417-431 | Polar residues | ||||
Sequence: SDSEPSASVSSRNVE | ||||||
Region | 417-497 | Disordered | ||||
Sequence: SDSEPSASVSSRNVERVESRNGRGSSGGGNSSGSSSSSSPSPSSSGESSESSSEMFEGSSEGGSSGPSRRDGRHRAPVTFD | ||||||
Compositional bias | 439-482 | Polar residues | ||||
Sequence: RGSSGGGNSSGSSSSSSPSPSSSGESSESSSEMFEGSSEGGSSG | ||||||
Zinc finger | 546-587 | RING-type | ||||
Sequence: CSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICR | ||||||
Motif | 597-600 | PDZ-binding | ||||
Sequence: ESVV |
Sequence similarities
Belongs to the RNF12 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length600
- Mass (Da)66,377
- Last updated2009-09-22 v2
- Checksum6BFB9958502FDAED
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 89-189 | Polar residues | ||||
Sequence: DDVTNSDSIIDWLNSVRQTGNTTRSGQRGNQSWRAVSRTNPNSGDFRFSLEINVNRNNGSQTSENESEPSTRRLSVENMESSSQRQMENSASESASARPSR | ||||||
Sequence conflict | 114 | in Ref. 1; AAD34209 | ||||
Sequence: G → R | ||||||
Sequence conflict | 146 | in Ref. 2; BAC26379 | ||||
Sequence: N → S | ||||||
Sequence conflict | 195 | in Ref. 1; AAD34209 | ||||
Sequence: A → T | ||||||
Compositional bias | 227-251 | Polar residues | ||||
Sequence: SRSPLQPTSEIPRRAPTLEQSSENE | ||||||
Sequence conflict | 228 | in Ref. 1; AAD34209 | ||||
Sequence: R → M | ||||||
Compositional bias | 282-310 | Polar residues | ||||
Sequence: SGSRNPSQGTSSSDTGSNSESSGSGQRPP | ||||||
Sequence conflict | 320 | in Ref. 2; BAC26379 | ||||
Sequence: R → G | ||||||
Compositional bias | 320-334 | Basic and acidic residues | ||||
Sequence: RVRPGEYRQRDSIAS | ||||||
Compositional bias | 335-352 | Polar residues | ||||
Sequence: RTRSRSQAPNNTVTYESE | ||||||
Sequence conflict | 362 | in Ref. 2; BAB28712 | ||||
Sequence: R → S | ||||||
Compositional bias | 417-431 | Polar residues | ||||
Sequence: SDSEPSASVSSRNVE | ||||||
Compositional bias | 439-482 | Polar residues | ||||
Sequence: RGSSGGGNSSGSSSSSSPSPSSSGESSESSSEMFEGSSEGGSSG | ||||||
Sequence conflict | 470 | in Ref. 1; AAD34209 | ||||
Sequence: E → K | ||||||
Sequence conflict | 486 | in Ref. 1; AAD34209 | ||||
Sequence: R → K | ||||||
Sequence conflict | 505 | in Ref. 1; AAD34209 | ||||
Sequence: L → F | ||||||
Sequence conflict | 557 | in Ref. 1; AAD34209 | ||||
Sequence: N → D | ||||||
Sequence conflict | 568 | in Ref. 1; AAD34209 | ||||
Sequence: Y → F |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF069992 EMBL· GenBank· DDBJ | AAD34209.1 EMBL· GenBank· DDBJ | mRNA | ||
AK013207 EMBL· GenBank· DDBJ | BAB28712.1 EMBL· GenBank· DDBJ | mRNA | ||
AK029295 EMBL· GenBank· DDBJ | BAC26379.1 EMBL· GenBank· DDBJ | mRNA | ||
AL805911 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH466564 EMBL· GenBank· DDBJ | EDL14089.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH466564 EMBL· GenBank· DDBJ | EDL14090.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC012960 EMBL· GenBank· DDBJ | AAH12960.1 EMBL· GenBank· DDBJ | mRNA |