Q9WTQ0 · KPCT_RAT
- ProteinProtein kinase C theta type
- GenePrkcq
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids707 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that mediates non-redundant functions in T-cell receptor (TCR) signaling, including T-cells activation, proliferation, differentiation and survival, by mediating activation of multiple transcription factors such as NF-kappa-B, JUN, NFATC1 and NFATC2. In TCR-CD3/CD28-co-stimulated T-cells, is required for the activation of NF-kappa-B and JUN, which in turn are essential for IL2 production, and participates in the calcium-dependent NFATC1 and NFATC2 transactivation. Mediates the activation of the canonical NF-kappa-B pathway (NFKB1) by direct phosphorylation of CARD11 on several serine residues, inducing CARD11 association with lipid rafts and recruitment of the BCL10-MALT1 complex, which then activates IKK complex, resulting in nuclear translocation and activation of NFKB1. May also play an indirect role in activation of the non-canonical NF-kappa-B (NFKB2) pathway. In the signaling pathway leading to JUN activation, acts by phosphorylating the mediator STK39/SPAK and may not act through MAP kinases signaling. Plays a critical role in TCR/CD28-induced NFATC1 and NFATC2 transactivation by participating in the regulation of reduced inositol 1,4,5-trisphosphate generation and intracellular calcium mobilization. After costimulation of T-cells through CD28 can phosphorylate CBLB and is required for the ubiquitination and subsequent degradation of CBLB, which is a prerequisite for the activation of TCR. During T-cells differentiation, plays an important role in the development of T-helper 2 (Th2) cells following immune and inflammatory responses, and, in the development of inflammatory autoimmune diseases, is necessary for the activation of IL17-producing Th17 cells. May play a minor role in Th1 response. Upon TCR stimulation, mediates T-cell protective survival signal by phosphorylating BAD, thus protecting T-cells from BAD-induced apoptosis, and by up-regulating BCL-X(L)/BCL2L1 levels through NF-kappa-B and JUN pathways. In platelets, regulates signal transduction downstream of the ITGA2B, CD36/GP4, F2R/PAR1 and F2RL3/PAR4 receptors, playing a positive role in 'outside-in' signaling and granule secretion signal transduction. May relay signals from the activated ITGA2B receptor by regulating the uncoupling of WASP and WIPF1, thereby permitting the regulation of actin filament nucleation and branching activity of the Arp2/3 complex. May mediate inhibitory effects of free fatty acids on insulin signaling by phosphorylating IRS1, which in turn blocks IRS1 tyrosine phosphorylation and downstream activation of the PI3K/AKT pathway. Phosphorylates MSN (moesin) in the presence of phosphatidylglycerol or phosphatidylinositol (By similarity).
Phosphorylates PDPK1 at 'Ser-504' and 'Ser-532' and negatively regulates its ability to phosphorylate PKB/AKT1 (By similarity).
Phosphorylates CCDC88A/GIV and inhibits its guanine nucleotide exchange factor activity (By similarity).
Phosphorylates and activates LRRK1, which phosphorylates RAB proteins involved in intracellular trafficking (By similarity).
Phosphorylates PDPK1 at 'Ser-504' and 'Ser-532' and negatively regulates its ability to phosphorylate PKB/AKT1 (By similarity).
Phosphorylates CCDC88A/GIV and inhibits its guanine nucleotide exchange factor activity (By similarity).
Phosphorylates and activates LRRK1, which phosphorylates RAB proteins involved in intracellular trafficking (By similarity).
Catalytic activity
- ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein]
Cofactor
Activity regulation
Novel PKCs (PRKCD, PRKCE, PRKCH and PRKCQ) are calcium-insensitive, but activated by diacylglycerol (DAG) and phosphatidylserine. Three specific sites; Thr-538 (activation loop of the kinase domain), Ser-676 (turn motif) and Ser-695 (hydrophobic region), need to be phosphorylated for its full activation (By similarity).
Features
Showing features for binding site, active site.
GO annotations
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein kinase C theta type
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ9WTQ0
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Peripheral membrane protein
Note: In resting T-cells, mostly localized in cytoplasm. In response to TCR stimulation, associates with lipid rafts and then localizes in the immunological synapse (By similarity).
Keywords
- Cellular component
Phenotypes & Variants
Chemistry
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000270836 | 1-707 | Protein kinase C theta type | |||
Sequence: MSPFLRIGLSNFDCGTCQACQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGRTEIWLELKPQGRMLMNARYFLEMSDTKDMSEFENEGFFALHHRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRRCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQARTLRDSEHIFREGPIEISFPRSIKSETRPPCVPTPGKSEPQGICWESPLDGADKTAQPPEPEVNLQRASLQLKLKIDDFILHKMLGKGSFGKVFLAEFKRTKQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEVILGLQFLHSKGIVYRDLKLDNILLDRDGHIKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEREAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPYDCSNFDKEFLSEKPRLSFADRALINSMDQNMFSNFSFINPGMETLICS | ||||||
Modified residue | 90 | Phosphotyrosine; by LCK | ||||
Sequence: Y | ||||||
Modified residue | 219 | Phosphothreonine; by autocatalysis | ||||
Sequence: T | ||||||
Modified residue | 348 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 538 | Phosphothreonine; by PDPK1 | ||||
Sequence: T | ||||||
Modified residue | 676 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 685 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 695 | Phosphoserine; by autocatalysis | ||||
Sequence: S |
Post-translational modification
Autophosphorylation at Thr-219 is required for targeting to the TCR and cellular function of PRKCQ upon antigen receptor ligation. Following TCR stimulation, phosphorylated at Tyr-90 and Ser-685 (By similarity).
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Part of a membrane raft complex composed at least of BCL10, CARD11, MALT1 and IKBKB (By similarity).
Interacts with GLRX3 (via N-terminus) (PubMed:18479680).
Interacts with ECT2 (By similarity).
Interacts with CCDC88A/GIV; the interaction leads to phosphorylation of CCDC88A and inhibition of its guanine nucleotide exchange factor activity (By similarity).
Interacts with CD28 (By similarity).
Interacts with GLRX3 (via N-terminus) (PubMed:18479680).
Interacts with ECT2 (By similarity).
Interacts with CCDC88A/GIV; the interaction leads to phosphorylation of CCDC88A and inhibition of its guanine nucleotide exchange factor activity (By similarity).
Interacts with CD28 (By similarity).
Protein-protein interaction databases
Chemistry
Structure
Family & Domains
Features
Showing features for domain, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-107 | C2 | ||||
Sequence: MSPFLRIGLSNFDCGTCQACQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGRTEIWL | ||||||
Zinc finger | 159-209 | Phorbol-ester/DAG-type 1 | ||||
Sequence: CHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRRCNAAIHKKCIDKVIAKC | ||||||
Zinc finger | 231-281 | Phorbol-ester/DAG-type 2 | ||||
Sequence: PHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLC | ||||||
Domain | 380-634 | Protein kinase | ||||
Sequence: FILHKMLGKGSFGKVFLAEFKRTKQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEVILGLQFLHSKGIVYRDLKLDNILLDRDGHIKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEREAKDLLVKLFVREPEKRLGVRGDIRQHPLF | ||||||
Domain | 635-706 | AGC-kinase C-terminal | ||||
Sequence: REINWEELERKEIDPPFRPKVKSPYDCSNFDKEFLSEKPRLSFADRALINSMDQNMFSNFSFINPGMETLIC |
Domain
The C1 domain, containing the phorbol ester/DAG-type region 1 (C1A) and 2 (C1B), is the diacylglycerol sensor and the C2 domain is a non-calcium binding domain.
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length707
- Mass (Da)81,750
- Last updated2007-01-09 v2
- Checksum7F82E35DE0C09DB9
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F1LM10 | F1LM10_RAT | Prkcq | 707 | ||
A0A8I6A0B5 | A0A8I6A0B5_RAT | Prkcq | 464 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AABR03106275 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AABR03107517 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AABR03106934 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AABR03106283 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AABR03107733 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AABR03106804 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AABR03108584 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AABR03106764 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AB020614 EMBL· GenBank· DDBJ | BAA78371.1 EMBL· GenBank· DDBJ | mRNA |