Q9W1X7 · MED23_DROME
- ProteinMediator of RNA polymerase II transcription subunit 23
- GeneMED23
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1439 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).
Required for transcriptional activation in response to heat shock
Required for transcriptional activation in response to heat shock
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mediator complex | |
Cellular Component | transcription regulator complex | |
Molecular Function | transcription coregulator activity | |
Biological Process | positive regulation of gene expression | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameMediator of RNA polymerase II transcription subunit 23
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ9W1X7
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000305937 | 1-1439 | Mediator of RNA polymerase II transcription subunit 23 | |||
Sequence: METQVIDTVNEFLKVDSLDEAFVSVIVFKPNTEQERATRFANDLVTAFGNVAQENREQVLRLYLLRAAGASGYHIKVLMAALVKLVDAHVITARMLCDKVLMCEKLDFEHRTFWIESFRLIKRVIVQVDYKGVREIMKVCRDKAQWFPLNVNVTYMPQLLAVEDILRFIFDRNNCLLPAYFIANEIMRPFPYHWKLNRLMTDFVEEFRTTAQMVSIIGHASMLPIVEHFGYADHMMNSWRLDHNTLKFNFKGSLPYEPELLEEQKPLLRYVLEQPYSREMVSQMLNLQKHQKQRYNALEEQLVNLIVQAMEMTEANDATAGSGFNSSDEQITPYEWMWLHLSSQLIYFVLFQFVSFMHIVLALHEKLSKLELRKGRDQLMWILLQFISGSIQKNPITNFLPVFRLFDLLYPELEPLKLPDINKSSMVRHMAPICVWIHLMKKARVENMNITRPLPIALKNHYDFLQHLVTANTMMNMTLGNDFRIILICNAYSTNQEYFGRPMGLLLDALNGTSKSPNGGQIPAVTFSVTVLDSLTVHSKMSLIHSFVTQMLKQAQSKGQVPAAALLETYARLLVYTEIESLGIKGFLSQLMPTVFKNHAWAMLHTLMEMFSYRLHHVPTHYRVQLLSLLHSLSSVPQTNKMQLNLCFESTALRLITSIGSAEFQPQFSRYFNDKSPGAVASNESEELNRVLILTLARSMHVHGGGDEMQGWCKDFLSNIIQHTPHSWPMHSLACFPPALNEYFTQNNQPPENKQQLKKAVEEEYRTWTSMTNENDIIAHFLRPTTNPLFLCLLFKIIWETENISPVAYKILEGISARALSTHLRKFCDYLVAEVASSSDGRDFIHKCVDTINNMIWKFNVVTIDRVVLCLALRTHEGNEAQVCFLIIQLLLLKASELRNRVQEFCKDNNPDHWKQSNWQDKHLSFHQKYPEKFALDESASQIPLPVYFSNVCLRFLPVLDVVVHRFIELTITNVHQILGFILDHLSILYKFHDRPITYLYNTLHYYERILRDRPALKKKLVGAITSAFSEIRPPNWSVSEPYKVYLQSQDSLWTPELSYYMSLIRRLADTISGKNVFYSTDWRFNEFPNAPTHALYVTCVELLGLPVAPPLVASNLIDVIVSGYAVIPQKDIHSYINAVGIVLAALPEPYWSGIYDRLQDMLNTPNMLNWTYRFNAFELFNFKTVREAMLEKTYAVVLAVAHSVFHHMGAFKLAAMTRYLKEKLKPCVRTEQQLLYLCHVFGPFLQRIELEKPNAVAGIAVLLYEILEIVDKHHGPKPLQYMDQICDFLYHIKYIHVGNIIKNESEAIIKRLRPLLQMRLRFITHLNLEDIHTEKINDNTSNNAITSQTQSPMQTQHQQQPQQPHQQQQQQQQQQQQQQQQQQQQQQMQQQQINAVQTTSVPLGSGGNLQQQQQINQQQQMYMQHMQQHQHMQNMRHN |
Proteomic databases
Expression
Gene expression databases
Interaction
Subunit
Component of the Mediator complex (By similarity).
Interacts with Hsf
Interacts with Hsf
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for coiled coil, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 282-318 | |||||
Sequence: SQMLNLQKHQKQRYNALEEQLVNLIVQAMEMTEANDA | ||||||
Region | 358-625 | Interaction with Hsf | ||||
Sequence: HIVLALHEKLSKLELRKGRDQLMWILLQFISGSIQKNPITNFLPVFRLFDLLYPELEPLKLPDINKSSMVRHMAPICVWIHLMKKARVENMNITRPLPIALKNHYDFLQHLVTANTMMNMTLGNDFRIILICNAYSTNQEYFGRPMGLLLDALNGTSKSPNGGQIPAVTFSVTVLDSLTVHSKMSLIHSFVTQMLKQAQSKGQVPAAALLETYARLLVYTEIESLGIKGFLSQLMPTVFKNHAWAMLHTLMEMFSYRLHHVPTHYRVQ | ||||||
Region | 1338-1372 | Disordered | ||||
Sequence: NDNTSNNAITSQTQSPMQTQHQQQPQQPHQQQQQQ | ||||||
Compositional bias | 1401-1432 | Polar residues | ||||
Sequence: SVPLGSGGNLQQQQQINQQQQMYMQHMQQHQH | ||||||
Region | 1401-1439 | Disordered | ||||
Sequence: SVPLGSGGNLQQQQQINQQQQMYMQHMQQHQHMQNMRHN |
Sequence similarities
Belongs to the Mediator complex subunit 23 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,439
- Mass (Da)167,065
- Last updated2000-05-01 v1
- Checksum1E07DD5F62EE5A81
Sequence caution
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 3 | in Ref. 3; ABM92808 | ||||
Sequence: T → A | ||||||
Sequence conflict | 504 | in Ref. 3; ABM92808 | ||||
Sequence: G → S | ||||||
Sequence conflict | 1319 | in Ref. 3; ABM92808 | ||||
Sequence: M → L | ||||||
Sequence conflict | 1366 | in Ref. 3; ABM92808 | ||||
Sequence: H → HQ | ||||||
Compositional bias | 1401-1432 | Polar residues | ||||
Sequence: SVPLGSGGNLQQQQQINQQQQMYMQHMQQHQH |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE013599 EMBL· GenBank· DDBJ | AAF46925.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT029934 EMBL· GenBank· DDBJ | ABM92808.1 EMBL· GenBank· DDBJ | mRNA | Different initiation |