Q9W0S3 · TI50B_DROME
- ProteinMitochondrial import inner membrane translocase subunit TIM50-B
- Genettm2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids409 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | mitochondrion | |
Cellular Component | nuclear speck | |
Cellular Component | TIM23 mitochondrial import inner membrane translocase complex | |
Molecular Function | protein serine/threonine phosphatase activity | |
Molecular Function | protein tyrosine phosphatase activity | |
Molecular Function | ribonucleoprotein complex binding | |
Biological Process | mitochondrial membrane organization | |
Biological Process | mitochondrion organization | |
Biological Process | protein dephosphorylation | |
Biological Process | protein import into mitochondrial matrix |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMitochondrial import inner membrane translocase subunit TIM50-B
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ9W0S3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Single-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 43-127 | Mitochondrial matrix | ||||
Sequence: GDVGKPGMELGRCSCFGLRVNLSNASVVYVGHRRYSTYEKTSTQILTKLFPQTSEESNDEESRERRKLEEEEEQKELERAFRRMK | ||||||
Transmembrane | 128-148 | Helical | ||||
Sequence: LGFGLFGIGSMLFSFWAIYFY | ||||||
Topological domain | 149-409 | Mitochondrial intermembrane | ||||
Sequence: GRPSLDEHGNEVIDEFSCLPQMQQLMWRTWKSVNRFQRFFKEPSRKKLLPDPLQPPYVQPPYTLVLEIKDVLVHPDWTYETGWRFKKRPGVDVFLKECAKYFEIVVYTAEQGVTVFPLVDALDPNGCIMYRLVRDSTHFDGGHHVKNLDNLNRDLKRVVVVDWDRNSTKFHPSNSFSIPRWSGNDNDTTLFELTSFLSVLGTSEIDDVREVLQYYNQFSDSLSQFRENQRKLGELMHAEEVEKTSKSRPVVKNWTRGFINH |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-42 | Mitochondrion | ||||
Sequence: MSLIAIERVLCGWPKICRKLIVTSRSLTSGLRRALVKQPRKG | ||||||
Chain | PRO_0000043122 | 43-409 | Mitochondrial import inner membrane translocase subunit TIM50-B | |||
Sequence: GDVGKPGMELGRCSCFGLRVNLSNASVVYVGHRRYSTYEKTSTQILTKLFPQTSEESNDEESRERRKLEEEEEQKELERAFRRMKLGFGLFGIGSMLFSFWAIYFYGRPSLDEHGNEVIDEFSCLPQMQQLMWRTWKSVNRFQRFFKEPSRKKLLPDPLQPPYVQPPYTLVLEIKDVLVHPDWTYETGWRFKKRPGVDVFLKECAKYFEIVVYTAEQGVTVFPLVDALDPNGCIMYRLVRDSTHFDGGHHVKNLDNLNRDLKRVVVVDWDRNSTKFHPSNSFSIPRWSGNDNDTTLFELTSFLSVLGTSEIDDVREVLQYYNQFSDSLSQFRENQRKLGELMHAEEVEKTSKSRPVVKNWTRGFINH |
Proteomic databases
Expression
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 93-114 | Disordered | ||||
Sequence: PQTSEESNDEESRERRKLEEEE | ||||||
Compositional bias | 96-114 | Basic and acidic residues | ||||
Sequence: SEESNDEESRERRKLEEEE | ||||||
Domain | 205-348 | FCP1 homology | ||||
Sequence: YVQPPYTLVLEIKDVLVHPDWTYETGWRFKKRPGVDVFLKECAKYFEIVVYTAEQGVTVFPLVDALDPNGCIMYRLVRDSTHFDGGHHVKNLDNLNRDLKRVVVVDWDRNSTKFHPSNSFSIPRWSGNDNDTTLFELTSFLSVL |
Sequence similarities
Belongs to the TIM50 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length409
- Mass (Da)47,706
- Last updated2000-05-01 v1
- ChecksumD1EBBCD191A9E645
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 96-114 | Basic and acidic residues | ||||
Sequence: SEESNDEESRERRKLEEEE |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE014296 EMBL· GenBank· DDBJ | AAF47370.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT031147 EMBL· GenBank· DDBJ | ABX00769.1 EMBL· GenBank· DDBJ | mRNA | ||
AY089295 EMBL· GenBank· DDBJ | AAL90033.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |