Q9W032 · ECD_DROME
- ProteinProtein ecdysoneless
- Geneecd
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids684 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Required in both the follicle cells and the germline for oocyte development.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | snRNP binding | |
Biological Process | chitin-based embryonic cuticle biosynthetic process | |
Biological Process | ecdysone biosynthetic process | |
Biological Process | germ cell development | |
Biological Process | germ-band shortening | |
Biological Process | Golgi organization | |
Biological Process | head involution | |
Biological Process | instar larval development | |
Biological Process | instar larval or pupal development | |
Biological Process | lymph gland development | |
Biological Process | Malpighian tubule morphogenesis | |
Biological Process | molting cycle, chitin-based cuticle | |
Biological Process | mRNA splicing, via spliceosome | |
Biological Process | mushroom body development | |
Biological Process | oogenesis | |
Biological Process | progression of morphogenetic furrow involved in compound eye morphogenesis | |
Biological Process | response to symbiont |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProtein ecdysoneless
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ9W032
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 656 | Temperature-sensitive mutation; disrupts production of the steroid hormone ecdysone, causes developmental and reproductive defects. | ||||
Sequence: P → S |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000220846 | 1-684 | Protein ecdysoneless | |||
Sequence: MSKIPGSNLEFVREEDFVEYYIFPKIPDNVQDEGALRKLMLQIRNEISAIVREKSLERSYLWHKDEFQLQVRLGGAEERLLNEETNPEEEAELGDLPPHFHGVTHYGDNISDEWFVVYLLTEITRARGDCIARVSDSDGEFLLIEAADALPDWASPETCEQRVYLVGGHLQLLQNSAASSQDKPLTMAMAVQRIRMNPTLYRCSQEIQSCIDARLKEYQIAQPHFSIHRQVLELPHSAAQLLKQKPRLLSSAVRAFCERDSLDIKALRTMRYFPPEATRVRTNVRFTRCLYAMLSHQQYLPEKRLGWHLTDPVSEPERYKEQLLGLKLASGLEILATQAKRVEGQQLEDLPAWRSYLRSLLSKGYFRDNIEGSAEYQELLNKAKVYFRGNQERFRTASRAGAEILDLLLHPAEAASEELRDEENNLQPSDSDEWLNISAEDLDSMLQDRYGPKKLYKPNGQMNAEEFTKQLAEFLDRQSNYEGIEHRGLEEPELDSDDDEPPPQANGSTGLTAKVKKNPSMRKACQRNSVIQPEEPDSTHVRNFLDFVIPEDNWDSTSEMSDYADEDDMESNLNALSGGGSVFPLDRQIQSYMEQMDRELAQTSVGKSFHGKKKTAPQADEDDFDDIEDFEPININVNTLRNMMDSYQSQVGGAGPVSNLFSAMGVGMSAVEDKEQKDISESAV |
Proteomic databases
Expression
Tissue specificity
Expressed in the ecdysone-producing larval ring gland, nervous system, imaginal disks and gonads.
Developmental stage
Expressed both maternally and zygotically throughout development.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 491-528 | Disordered | ||||
Sequence: EPELDSDDDEPPPQANGSTGLTAKVKKNPSMRKACQRN | ||||||
Region | 603-624 | Disordered | ||||
Sequence: TSVGKSFHGKKKTAPQADEDDF |
Sequence similarities
Belongs to the ECD family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length684
- Mass (Da)77,908
- Last updated2000-05-01 v1
- ChecksumD59B5C943E352F30
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE014296 EMBL· GenBank· DDBJ | AAF47628.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY051483 EMBL· GenBank· DDBJ | AAK92907.1 EMBL· GenBank· DDBJ | mRNA |