Q9VXH6 · CANC_DROME
- ProteinCalpain-C
- GeneCalpC
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids681 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Not known; does not seem to have protease activity.
Miscellaneous
Although strongly related to peptidase C2 proteins, it lack the essential Cys, His and Asn residues of the catalytic triad at positions 84, 242 and 267, respectively.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | calcium ion binding |
Keywords
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCalpain-C
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ9VXH6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000207732 | 1-681 | Calpain-C | |||
Sequence: MASKYERILSDCRSKNVLWEDPDFPAVQSSVFYYQTPPFTFQWKRIMDLADSGSGAVAANSSAAPVFLNESAEFDVVPGKMGDRWLVSCLGLLSSLRNLFYRVVPADQTLASAHGVFRFRLWWCGEWVEVLVDDRLPTINGRLAFMQPQASNCFWAALLEKAIAKLHGSYEALKYGTRSDGLTDLLGGVVRQMPILSDNIRPQTLKELLTTTCIVTCLADKSATVAKKNLAERMPNGILVNVNYRLSSLDKVKTLMGDSVQLVCLKDTFSSKPFGEKTHFLGDWSPMSKTWERVSQVERARLIRQLGPGEFWLSFCDFVEIFSTMEVVYLDTETSNDEEMLKSRPLHWKMKMHQGQWKRGVTAGGCRNHESFHINPQLLISVQDEQDLVIALNQHTAVEPKVIGFTMYTWDGEYMLSECLQKDFFKNHVSYLNSDYGNTRHVSYHTHLEAGHYVLIPTTYEPAEEAHFTVRILGTGSFRLSCLETQTMILLDPFPALKSTDAERCGGPKVKSVCQYEPVYMQLADENKTINCFELHELLEACLPNDYIKGCANIDICRQVIALQDRSGSGRITFQQFKTFMVNLKSWQGVFKMYTKEKAGILRAERLRDALCDIGFQLSTDIMNCLIQRYIRKDGTLRLSDFVSAVIHLTTAFNQFHLKNYGQVNVIEVHLHDWIKSILSC |
Proteomic databases
Expression
Tissue specificity
Localized to the salivary glands in the larva.
Developmental stage
Expressed throughout development, with expression highest in the pupa.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 18-331 | Calpain catalytic | ||||
Sequence: LWEDPDFPAVQSSVFYYQTPPFTFQWKRIMDLADSGSGAVAANSSAAPVFLNESAEFDVVPGKMGDRWLVSCLGLLSSLRNLFYRVVPADQTLASAHGVFRFRLWWCGEWVEVLVDDRLPTINGRLAFMQPQASNCFWAALLEKAIAKLHGSYEALKYGTRSDGLTDLLGGVVRQMPILSDNIRPQTLKELLTTTCIVTCLADKSATVAKKNLAERMPNGILVNVNYRLSSLDKVKTLMGDSVQLVCLKDTFSSKPFGEKTHFLGDWSPMSKTWERVSQVERARLIRQLGPGEFWLSFCDFVEIFSTMEVVYLD | ||||||
Region | 332-481 | Domain III | ||||
Sequence: TETSNDEEMLKSRPLHWKMKMHQGQWKRGVTAGGCRNHESFHINPQLLISVQDEQDLVIALNQHTAVEPKVIGFTMYTWDGEYMLSECLQKDFFKNHVSYLNSDYGNTRHVSYHTHLEAGHYVLIPTTYEPAEEAHFTVRILGTGSFRLS | ||||||
Region | 482-514 | Linker | ||||
Sequence: CLETQTMILLDPFPALKSTDAERCGGPKVKSVC | ||||||
Region | 515-681 | Domain IV | ||||
Sequence: QYEPVYMQLADENKTINCFELHELLEACLPNDYIKGCANIDICRQVIALQDRSGSGRITFQQFKTFMVNLKSWQGVFKMYTKEKAGILRAERLRDALCDIGFQLSTDIMNCLIQRYIRKDGTLRLSDFVSAVIHLTTAFNQFHLKNYGQVNVIEVHLHDWIKSILSC | ||||||
Domain | 552-587 | EF-hand | ||||
Sequence: ANIDICRQVIALQDRSGSGRITFQQFKTFMVNLKSW |
Sequence similarities
Belongs to the peptidase C2 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length681
- Mass (Da)77,448
- Last updated2009-03-24 v4
- Checksum67B4FDD05122E9D3
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 71 | in Ref. 1; CAD61271 and 4; AAL29115 | ||||
Sequence: S → T | ||||||
Sequence conflict | 197 | in Ref. 1; CAD61271 and 4; AAL29115 | ||||
Sequence: S → A | ||||||
Sequence conflict | 241 | in Ref. 4; AAL29115 | ||||
Sequence: N → Y | ||||||
Sequence conflict | 623 | in Ref. 4; AAL29115 | ||||
Sequence: M → T |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ538040 EMBL· GenBank· DDBJ | CAD61271.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014298 EMBL· GenBank· DDBJ | AAF48591.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY061567 EMBL· GenBank· DDBJ | AAL29115.1 EMBL· GenBank· DDBJ | mRNA |