Q9VWX8 · FRQ2_DROME
- ProteinFrequenin-2
- GeneFrq2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids187 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a role in synaptic transmission and axon terminal morphology (PubMed:17970740).
Inhibits ric8a-mediated promotion of synapse number but does not affect ric8a-mediated neurotransmitter release (PubMed:25074811).
Inhibits ric8a-mediated promotion of synapse number but does not affect ric8a-mediated neurotransmitter release (PubMed:25074811).
Miscellaneous
Binds 3 calcium ions via the second, third and fourth EF-hands.
Phenothiazine FD44 binds to frq2 and disrupts interaction of frq2 with ric8a (PubMed:28119500).
This leads to reduction of synapse number to normal levels and restoration of normal learning performance in a Drosophila model of fragile X syndrome, suggesting that the interaction interface may be a suitable target for the treatment of fragile X and other synaptopathies (PubMed:28119500).
This leads to reduction of synapse number to normal levels and restoration of normal learning performance in a Drosophila model of fragile X syndrome, suggesting that the interaction interface may be a suitable target for the treatment of fragile X and other synaptopathies (PubMed:28119500).
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 73 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 75 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 77 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 79 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: A | ||||||
Binding site | 84 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 109 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 111 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 113 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 115 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 120 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 156 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 158 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 160 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 162 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 167 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | synaptic vesicle | |
Molecular Function | calcium ion binding | |
Molecular Function | calcium sensitive guanylate cyclase activator activity | |
Biological Process | chemical synaptic transmission | |
Biological Process | neuromuscular junction development | |
Biological Process | neurotransmitter secretion | |
Biological Process | regulation of neurotransmitter secretion | |
Biological Process | vesicle-mediated transport |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameFrequenin-2
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ9VWX8
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Increased number of type Is boutons in neuromuscular junctions of abdominal segment 3 muscle fibers and reduced nerve-evoked excitatory junction potential.
Features
Showing features for mutagenesis, natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 84 | Does not affect interaction with ric8a; when associated with A-120 and A-167. | ||||
Sequence: E → A | ||||||
Mutagenesis | 120 | Does not affect interaction with ric8a; when associated with A-84 and A-167. | ||||
Sequence: E → A | ||||||
Mutagenesis | 167 | Does not affect interaction with ric8a; when associated with A-84 and A-120. | ||||
Sequence: E → A | ||||||
Mutagenesis | 176-187 | Increased binding to ric8a. | ||||
Sequence: Missing | ||||||
Natural variant | 178 | in RNA edited version | ||||
Sequence: I → M |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1 variant from UniProt as well as other sources including ClinVar and dbSNP.
Chemistry
PTM/Processing
Features
Showing features for initiator methionine, lipidation, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Lipidation | 2 | N-myristoyl glycine | ||||
Sequence: G | ||||||
Chain | PRO_0000458652 | 2-187 | Frequenin-2 | |||
Sequence: GKKNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLGGD |
Keywords
- PTM
Proteomic databases
Expression
Tissue specificity
In the embryo, highly expressed in the ventral ganglia.
Developmental stage
Detected in first instar larva and adult with higher levels in adult than in larva.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 29-54 | EF-hand 1 | ||||
Sequence: QWHKGFLKDCPNGLLTEQGFIKIYKQ | ||||||
Domain | 60-95 | EF-hand 2 | ||||
Sequence: DPSKFASLVFRVFDENNDGAIEFEEFIRALSITSRG | ||||||
Domain | 96-131 | EF-hand 3 | ||||
Sequence: NLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQM | ||||||
Domain | 143-178 | EF-hand 4 | ||||
Sequence: TPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRI |
Sequence similarities
Belongs to the recoverin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length187
- Mass (Da)21,875
- Last updated2000-05-01 v1
- ChecksumF12AADF07BB8249D
RNA Editing
Edited at position 178
Partially edited
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE014298 EMBL· GenBank· DDBJ | AAF48809.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014298 EMBL· GenBank· DDBJ | AAS65399.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014298 EMBL· GenBank· DDBJ | AAS65400.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014298 EMBL· GenBank· DDBJ | AGB95517.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT133347 EMBL· GenBank· DDBJ | AFF57512.1 EMBL· GenBank· DDBJ | mRNA |