Q9VVX0 · GEMI2_DROME
- ProteinGem-associated protein 2
- GeneGem2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids245 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the survival motor neuron (SMN) complex that catalyzes the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome, and thereby plays an important role in the splicing of cellular pre-mRNAs (PubMed:18621711, PubMed:23333303, PubMed:30563832).
Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP (Sm core) (By similarity).
In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG (5Sm) are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP (By similarity).
To assemble core snRNPs, the SMN complex accepts the trapped 5Sm proteins from CLNS1A (By similarity).
Binding of snRNA inside 5Sm ultimately triggers eviction of the SMN complex, thereby allowing binding of SNRPD3 and SNRPB to complete assembly of the core snRNP (By similarity).
Within the SMN complex, GEMIN2 constrains the conformation of 5Sm, thereby promoting 5Sm binding to snRNA containing the snRNP code (a nonameric Sm site and a 3'-adjacent stem-loop), thus preventing progression of assembly until a cognate substrate is bound (By similarity).
Involved in adult motor function (PubMed:26098872).
Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP (Sm core) (By similarity).
In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG (5Sm) are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP (By similarity).
To assemble core snRNPs, the SMN complex accepts the trapped 5Sm proteins from CLNS1A (By similarity).
Binding of snRNA inside 5Sm ultimately triggers eviction of the SMN complex, thereby allowing binding of SNRPD3 and SNRPB to complete assembly of the core snRNP (By similarity).
Within the SMN complex, GEMIN2 constrains the conformation of 5Sm, thereby promoting 5Sm binding to snRNA containing the snRNP code (a nonameric Sm site and a 3'-adjacent stem-loop), thus preventing progression of assembly until a cognate substrate is bound (By similarity).
Involved in adult motor function (PubMed:26098872).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasmic U snRNP body | |
Cellular Component | nucleus | |
Cellular Component | SmD-containing SMN-Sm protein complex | |
Cellular Component | SMN complex | |
Cellular Component | SMN-Gemin2 complex | |
Cellular Component | spliceosomal complex | |
Biological Process | adult locomotory behavior | |
Biological Process | flight behavior | |
Biological Process | protein-RNA complex assembly | |
Biological Process | spliceosomal complex assembly | |
Biological Process | spliceosomal snRNP assembly |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameGem-associated protein 2
- Short namesGemin2
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ9VVX0
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown is late larval to adult lethal; the phenotype is the same if knockdown is restricted to muscle tissue (PubMed:24391840).
Conditional RNAi-mediated knockdown in adult muscle tissue results in age-dependent decline of motor functions, including climbing ability and flight (PubMed:24391840).
Conditional RNAi-mediated knockdown in adult muscle tissue results in age-dependent decline of motor functions, including climbing ability and flight (PubMed:24391840).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000424375 | 1-245 | Gem-associated protein 2 | |||
Sequence: MQHEPEDQTFQLQALEICEPDSSFDPQKPPESGEEYLMHMFYERKRCPAVVTKRSSKIRNNTGNTTLEMLDNPELPPFKCLLPTPEWRDEQVKSFQAARSQVLVLRKELANNNYDQSGEPPLTSDQEKWKEFCRNQQPLLSTLLHLTQNDLELLLEMLSKWLQDPNTTVDLLHDVWLARWLYATLVCLHLPLEPHVFSTLRYIARTCIHLRNQLKEDEVQRAAPYNLLLTLTVQVFAQNDFKDYI |
Proteomic databases
Expression
Interaction
Subunit
Component of the core survival motor neuron (SMN) complex composed of Smn, Gem2, Gem3, rig/Gem5 and one of 3 almost identical Gem4 paralogs encoded by Glos/Gem4a, Gem4b or Gem4c (PubMed:30563832).
Part of a minimal SMN complex composed of Smn and Gem2 only; this complex is active in UsnRNP assembly (PubMed:18621711, PubMed:23333303).
The SMN complex associates with the entire set of spliceosomal snRNP Sm proteins, SmB, SmD1, SmD2, SmD3, SmE, SmF and SmG, and with the snRNP-specific proteins snRNP-U1-70K, U2A, snf/U1A and U5-116KD (PubMed:18621711, PubMed:23333303).
Part of a minimal SMN complex composed of Smn and Gem2 only; this complex is active in UsnRNP assembly (PubMed:18621711, PubMed:23333303).
The SMN complex associates with the entire set of spliceosomal snRNP Sm proteins, SmB, SmD1, SmD2, SmD3, SmE, SmF and SmG, and with the snRNP-specific proteins snRNP-U1-70K, U2A, snf/U1A and U5-116KD (PubMed:18621711, PubMed:23333303).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9VVX0 | Smn Q9VV74 | 5 | EBI-108834, EBI-185315 |
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length245
- Mass (Da)28,751
- Last updated2000-05-01 v1
- Checksum1E9A700ADD97EDFF
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE014296 EMBL· GenBank· DDBJ | AAF49187.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014296 EMBL· GenBank· DDBJ | AGB94727.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY069703 EMBL· GenBank· DDBJ | AAL39848.2 EMBL· GenBank· DDBJ | mRNA | Different initiation |