Q9VTN0 · GR68A_DROME
- ProteinGustatory receptor 68a
- GeneGr68a
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids389 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Dsx-dependent essential component of pheromone-driven courtship behavior (PubMed:12971900).
Recognizes a female pheromone involved in the second step (tapping step) of the courtship display which is essential for efficient execution of the entire courtship sequence and timely mating (PubMed:12971900).
Required for detection of the male sex pheromone CH503 which is transferred from males to females during mating and inhibits courtship behavior by other males (PubMed:26083710).
Gr68a-expressing neurons in the male foreleg relay signals to the suboesophageal zone (SEZ) and courtship suppression is mediated by the release of the neuropeptide tachykinin from a cluster of 8-10 neurons in the SEZ (PubMed:26083710).
Recognizes a female pheromone involved in the second step (tapping step) of the courtship display which is essential for efficient execution of the entire courtship sequence and timely mating (PubMed:12971900).
Required for detection of the male sex pheromone CH503 which is transferred from males to females during mating and inhibits courtship behavior by other males (PubMed:26083710).
Gr68a-expressing neurons in the male foreleg relay signals to the suboesophageal zone (SEZ) and courtship suppression is mediated by the release of the neuropeptide tachykinin from a cluster of 8-10 neurons in the SEZ (PubMed:26083710).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axon | |
Cellular Component | dendrite | |
Cellular Component | membrane | |
Cellular Component | neuronal cell body | |
Cellular Component | plasma membrane | |
Molecular Function | ligand-gated monoatomic ion channel activity | |
Molecular Function | taste receptor activity | |
Biological Process | chemosensory behavior | |
Biological Process | detection of chemical stimulus involved in sensory perception of taste | |
Biological Process | male courtship behavior | |
Biological Process | male courtship behavior, tapping to detect pheromone | |
Biological Process | monoatomic ion transmembrane transport | |
Biological Process | response to pheromone | |
Biological Process | sensory perception of taste | |
Biological Process | signal transduction |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameGustatory receptor 68a
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ9VTN0
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-42 | Cytoplasmic | ||||
Sequence: MKIYQDIYPISKPSQIFAILPFYSGDVDDGFRFGGLGRWYGR | ||||||
Transmembrane | 43-63 | Helical; Name=1 | ||||
Sequence: LVALIILIGSLTLGEDVLFAS | ||||||
Topological domain | 64-82 | Extracellular | ||||
Sequence: KEYRLVASAQGDTEEINRT | ||||||
Transmembrane | 83-103 | Helical; Name=2 | ||||
Sequence: IETLLCIISYTMVVLSSVQNA | ||||||
Topological domain | 104-133 | Cytoplasmic | ||||
Sequence: SRHFRTLHDIAKIDEYLLANGFRETYSCRN | ||||||
Transmembrane | 134-154 | Helical; Name=3 | ||||
Sequence: LTILVTSAAGGVLAVAFYYIH | ||||||
Topological domain | 155-164 | Extracellular | ||||
Sequence: YRSGIGAKRQ | ||||||
Transmembrane | 165-185 | Helical; Name=4 | ||||
Sequence: IILLLIYFLQLLYSTLLALYL | ||||||
Topological domain | 186-236 | Cytoplasmic | ||||
Sequence: RTLMMNLAQRIGFLNQKLDTFNLQDCGHMENWRELSNLIEVLCKFRYITEN | ||||||
Transmembrane | 237-257 | Helical; Name=5 | ||||
Sequence: INCVAGVSLLFYFGFSFYTVT | ||||||
Topological domain | 258-281 | Extracellular | ||||
Sequence: NQSYLAFATLTAGSLSSKTEVADT | ||||||
Transmembrane | 282-302 | Helical; Name=6 | ||||
Sequence: IGLSCIWVLAETITMIVICSA | ||||||
Topological domain | 303-352 | Cytoplasmic | ||||
Sequence: CDGLASEVNGTAQILARIYGKSKQFQNLIDKFLTKSIKQDLQFTAYGFFS | ||||||
Transmembrane | 353-373 | Helical; Name=7 | ||||
Sequence: IDNSTLFKIFSAVTTYLVILI | ||||||
Topological domain | 374-389 | Extracellular | ||||
Sequence: QFKQLEDSKVEDISQA |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Mutant males display robust courtship behavior in the presence of CH503-perfumed females.
PTM/Processing
Features
Showing features for chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000216536 | 1-389 | Gustatory receptor 68a | |||
Sequence: MKIYQDIYPISKPSQIFAILPFYSGDVDDGFRFGGLGRWYGRLVALIILIGSLTLGEDVLFASKEYRLVASAQGDTEEINRTIETLLCIISYTMVVLSSVQNASRHFRTLHDIAKIDEYLLANGFRETYSCRNLTILVTSAAGGVLAVAFYYIHYRSGIGAKRQIILLLIYFLQLLYSTLLALYLRTLMMNLAQRIGFLNQKLDTFNLQDCGHMENWRELSNLIEVLCKFRYITENINCVAGVSLLFYFGFSFYTVTNQSYLAFATLTAGSLSSKTEVADTIGLSCIWVLAETITMIVICSACDGLASEVNGTAQILARIYGKSKQFQNLIDKFLTKSIKQDLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQFKQLEDSKVEDISQA | ||||||
Glycosylation | 80 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 258 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in chemosensory neurons of about 20 male-specific gustatory bristles in the forelegs (PubMed:12971900).
No expression is seen in the mechanosensory neurons (PubMed:12971900).
In larvae, expressed in the ventral pharyngeal sense organ (PubMed:22031876).
No expression is seen in the mechanosensory neurons (PubMed:12971900).
In larvae, expressed in the ventral pharyngeal sense organ (PubMed:22031876).
Gene expression databases
Structure
Family & Domains
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length389
- Mass (Da)43,780
- Last updated2002-05-02 v2
- Checksum59A55E4895BDEC3B
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE014296 EMBL· GenBank· DDBJ | AAF50017.2 EMBL· GenBank· DDBJ | Genomic DNA |