Q9VTM6 · CRIM_DROME
- ProteinUPAR/Ly6 domain-containing protein crim
- Genecrim
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids158 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Required for septate junction assembly possibly by organizing the preassembly and transport of septate junction proteins (PubMed:20570942).
Involved in epithelial cell septate junction-mediated paracellular barrier functions of trachea, hindgut and salivary gland (PubMed:20570942).
Involved in epithelial cell septate junction-mediated paracellular barrier functions of trachea, hindgut and salivary gland (PubMed:20570942).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | septate junction | |
Cellular Component | side of membrane | |
Biological Process | liquid clearance, open tracheal system | |
Biological Process | regulation of synaptic transmission, cholinergic | |
Biological Process | regulation of tube size, open tracheal system | |
Biological Process | rhythmic process | |
Biological Process | septate junction assembly | |
Biological Process | sleep |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameUPAR/Ly6 domain-containing protein crim
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ9VTM6
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Lipid-anchor, GPI-anchor
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 23-136 | Extracellular | ||||
Sequence: IWCYRCTSATPGCAEKFNWRGIGFLGEHCPEPDDICVKVTERRGARETITRDCLSALSFRKDIPADKYEGCRPAAHDEKLANYVNHTIKEHDVRRDYYTDTTFCFCFLDHRCNG | ||||||
Transmembrane | 137-157 | Helical | ||||
Sequence: ASGLQTSAVIGLLTLIPALLL | ||||||
Topological domain | 158 | Cytoplasmic | ||||
Sequence: R |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Conditional RNAi mediated knock-down in tracheal cells leads to aberrant tracheal dorsal trunk development resulting in tracheal tube size defects (PubMed:20570942).
Conditional RNAi knock-down in tracheal cells compromises epithelial paracellular barrier function in trachea due to reduced and irregular septate junction formation (PubMed:20570942).
Conditional RNAi knock-down in tracheal cells compromises epithelial paracellular barrier function in trachea due to reduced and irregular septate junction formation (PubMed:20570942).
PTM/Processing
Features
Showing features for signal, chain, glycosylation, lipidation, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MHYHTNLIAALLLAALIHEGSA | ||||||
Chain | PRO_5015100625 | 23-135 | UPAR/Ly6 domain-containing protein crim | |||
Sequence: IWCYRCTSATPGCAEKFNWRGIGFLGEHCPEPDDICVKVTERRGARETITRDCLSALSFRKDIPADKYEGCRPAAHDEKLANYVNHTIKEHDVRRDYYTDTTFCFCFLDHRCN | ||||||
Glycosylation | 107 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Lipidation | 135 | GPI-anchor amidated asparagine | ||||
Sequence: N | ||||||
Propeptide | PRO_0000459698 | 136-158 | Removed in mature form | |||
Sequence: GASGLQTSAVIGLLTLIPALLLR |
Keywords
- PTM
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Sequence similarities
Belongs to the quiver family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length158
- Mass (Da)17,744
- Last updated2000-05-01 v1
- ChecksumDD974BBCB148BCCA
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE014296 EMBL· GenBank· DDBJ | AAF50021.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY060768 EMBL· GenBank· DDBJ | AAL28316.1 EMBL· GenBank· DDBJ | mRNA | ||
KX531850 EMBL· GenBank· DDBJ | ANY27660.1 EMBL· GenBank· DDBJ | mRNA |