Q9VJQ5 · NC2B_DROME
- ProteinProtein Dr1
- GeneNC2beta
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids183 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Bifunctional basic transcription factor. Activates transcription of DPE (Downstream Promoter Element) containing promoters while repressing transcription of promoters which contain TATA elements (PubMed:11062130).
Together with Chrac-14, promotes nucleosome sliding of ATP-dependent nucelosome remodeling complexes (PubMed:18327268).
Together with Chrac-14, promotes nucleosome sliding of ATP-dependent nucelosome remodeling complexes (PubMed:18327268).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | ATAC complex | |
Cellular Component | negative cofactor 2 complex | |
Cellular Component | nucleus | |
Molecular Function | core promoter sequence-specific DNA binding | |
Molecular Function | DNA-binding transcription factor binding | |
Molecular Function | protein heterodimerization activity | |
Molecular Function | RNA polymerase II general transcription initiation factor activity | |
Molecular Function | TBP-class protein binding | |
Biological Process | chromatin remodeling | |
Biological Process | negative regulation of DNA-templated transcription | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | positive regulation of DNA-templated transcription | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | RNA polymerase II preinitiation complex assembly |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein Dr1
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ9VJQ5
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000096752 | 1-183 | Protein Dr1 | |||
Sequence: MSNPQEELLPPSAEDDELTLPRASINKIIKELVPTVRVANESRELILNCCSEFIHLISSEANEVCNMRNKKTINAEHVLEALERLGFHDYKQEAEAVLHDCKEVAAKRRRQSTRLENLGIPEEELLRQQQELFAKAREEQAREEQQQWMSMQAAAMVQRPPLADGSVASKPSEDDDDDDDDDY |
Proteomic databases
Expression
Gene expression databases
Interaction
Subunit
Component of the Ada2a-containing (ATAC) complex composed of at least Ada2a, Atac1, Hcf, Ada3, Gcn5, Mocs2B, Charac-14, Atac3, Atac2, NC2beta and wds (PubMed:18327268).
Homodimer (PubMed:18327268).
Interacts with NC2-alpha/Drap1 to form the dNC2 complex (PubMed:11062130).
Homodimer (PubMed:18327268).
Interacts with NC2-alpha/Drap1 to form the dNC2 complex (PubMed:11062130).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9VJQ5 | NC2alpha Q9GSP1 | 4 | EBI-176193, EBI-22062696 | |
BINARY | Q9VJQ5 | Taf11 P49906 | 3 | EBI-176193, EBI-187533 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 19-82 | Histone-fold | ||||
Sequence: TLPRASINKIIKELVPTVRVANESRELILNCCSEFIHLISSEANEVCNMRNKKTINAEHVLEAL | ||||||
Region | 92-183 | Repression of TATA-containing promoters | ||||
Sequence: QEAEAVLHDCKEVAAKRRRQSTRLENLGIPEEELLRQQQELFAKAREEQAREEQQQWMSMQAAAMVQRPPLADGSVASKPSEDDDDDDDDDY | ||||||
Region | 155-183 | Disordered | ||||
Sequence: AMVQRPPLADGSVASKPSEDDDDDDDDDY |
Sequence similarities
Belongs to the NC2 beta/DR1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length183
- Mass (Da)20,914
- Last updated2000-05-01 v1
- ChecksumBE7B25679CE02F7C
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF302257 EMBL· GenBank· DDBJ | AAG15388.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014134 EMBL· GenBank· DDBJ | AAF53428.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY060717 EMBL· GenBank· DDBJ | AAL28265.2 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
DQ138728 EMBL· GenBank· DDBJ | ABA86334.1 EMBL· GenBank· DDBJ | Genomic DNA |