Q9VFX1 · WNT8_DROME
- ProteinWnt inhibitor of Dorsal protein
- GenewntD
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids309 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Binds as a ligand to a family of frizzled seven-transmembrane receptors and acts through a cascade of genes on the nucleus.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular matrix | |
Cellular Component | extracellular region | |
Cellular Component | extracellular space | |
Molecular Function | cytokine activity | |
Molecular Function | frizzled binding | |
Biological Process | canonical Wnt signaling pathway | |
Biological Process | cell fate commitment | |
Biological Process | defense response to Gram-positive bacterium | |
Biological Process | germ cell migration | |
Biological Process | neuron differentiation | |
Biological Process | non-canonical Wnt signaling pathway | |
Biological Process | regulation of embryonic development | |
Biological Process | ventral furrow formation |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameWnt inhibitor of Dorsal protein
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ9VFX1
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-16 | |||||
Sequence: MIFAITFFMGITSTLA | ||||||
Chain | PRO_0000041480 | 17-309 | Wnt inhibitor of Dorsal protein | |||
Sequence: AVLEPMSYYQYTQFQAPLSWEDITGKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANGVIAGCGCTENALNVPCAHEPTKALEQYEKHFGSGSGAIGHNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLEGASSNLKIMWQNIPLDSLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSCY | ||||||
Disulfide bond | 51↔62 | |||||
Sequence: CQQSFQWQRWNC | ||||||
Disulfide bond | 102↔110 | |||||
Sequence: CANGVIAGC | ||||||
Disulfide bond | 112↔121 | |||||
Sequence: CTENALNVPC | ||||||
Disulfide bond | 162↔179 | |||||
Sequence: CRCKQPGAVQGECQEEEC | ||||||
Disulfide bond | 164↔174 | |||||
Sequence: CKQPGAVQGEC | ||||||
Disulfide bond | 232↔269 | |||||
Sequence: CERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVC | ||||||
Disulfide bond | 248↔262 | |||||
Sequence: CSKDGSGSLEERLSC | ||||||
Disulfide bond | 266↔308 | |||||
Sequence: CRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC | ||||||
Disulfide bond | 284↔299 | |||||
Sequence: CNCKLVWGFRLQCDVC | ||||||
Disulfide bond | 286↔296 | |||||
Sequence: CKLVWGFRLQC |
Keywords
- PTM
Proteomic databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length309
- Mass (Da)34,777
- Last updated2001-03-01 v2
- ChecksumBA6AC2F3198B4DAD
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE014297 EMBL· GenBank· DDBJ | AAF54924.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY071538 EMBL· GenBank· DDBJ | AAL49160.1 EMBL· GenBank· DDBJ | mRNA |