Q9VEX0 · SULF1_DROME
- ProteinExtracellular sulfatase SULF-1 homolog
- GeneSulf1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1114 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
Cofactor
Note: Binds 1 Ca2+ ion per subunit.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 62 | Ca2+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 63 | Ca2+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Active site | 98 | Nucleophile | ||||
Sequence: C | ||||||
Binding site | 98 | Ca2+ (UniProtKB | ChEBI); via 3-oxoalanine | ||||
Sequence: C | ||||||
Binding site | 327 | Ca2+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 328 | Ca2+ (UniProtKB | ChEBI) | ||||
Sequence: H |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell surface | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | extracellular space | |
Cellular Component | Golgi stack | |
Molecular Function | glycosaminoglycan binding | |
Molecular Function | metal ion binding | |
Molecular Function | N-acetylglucosamine-6-sulfatase activity | |
Biological Process | heparin metabolic process | |
Biological Process | motor neuron axon guidance | |
Biological Process | negative regulation of canonical Wnt signaling pathway | |
Biological Process | negative regulation of epidermal growth factor receptor signaling pathway | |
Biological Process | negative regulation of smoothened signaling pathway | |
Biological Process | positive regulation of smoothened signaling pathway | |
Biological Process | synaptic target inhibition | |
Biological Process | wing disc anterior/posterior pattern formation | |
Biological Process | wing disc dorsal/ventral pattern formation |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameExtracellular sulfatase SULF-1 homolog
- EC number
- Short namesDmSulf-1
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ9VEX0
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Also localized on the cell surface.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, modified residue, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-25 | |||||
Sequence: MMRHSSLRLIIGGLILLLFVLNVFS | ||||||
Chain | PRO_0000033439 | 26-1114 | Extracellular sulfatase SULF-1 homolog | |||
Sequence: KEQGSHSHKRSHSAKRFSRDSNSARERRPNIILILTDDQDVELGSLNFMPRTLRLLRDGGAEFRHAYTTTPMCCPARSSLLTGMYVHNHMVFTNNDNCSSPQWQATHETRSYATYLSNAGYRTGYFGKYLNKYNGSYIPPGWREWGGLIMNSKYYNYSINLNGQKIKHGFDYAKDYYPDLIANDSIAFLRSSKQQNQRKPVLLTMSFPAPHGPEDSAPQYSHLFFNVTTHHTPSYDHAPNPDKQWILRVTEPMQPVHKRFTNLLMTKRLQTLQSVDVAVERVYNELKELGELDNTYIVYTSDHGYHLGQFGLIKGKSFPFEFDVRVPFLIRGPGIQASKVVNEIVLNVDLAPTFLDMGGVPTPQHMDGRSILPLLLSRNRAVRDNWPDSFLIESSGRRETAEQIAESRARLQIERRNMKLANSSLLEDFLEGAGESTTIVSSSSTAATLMSSTAQQPEDGEEEVETDNEEDDVDGDGAMDSSAAALEEDDLDDAAFEEGDEELDQEFQQNNDLPLAPYITKMMRLNSECSDPALLKNCLPGQKWKCVNEEGRWRKHKCKFHLQLEHQLAAMPRKQYQRNCACFTPDGVVYTKIRAPSAGLHRVNKRTHNGPGRRRNKREVFHTELPDEMEELLDLHQVVDQLVDHTHRSKRDLPASSNETIAQVIQQIQSTLEILELKFNEHELHASNSSGNSYERGEKYTKSGGHRCFVDATTAKVNCSNVIYDDEKTWRTSRTQIDMLIKLLKDKIGKLKEMKKQLRESNKQALAAGRRNDNRRRNDQSVLDSGAGPEFNMSYFTEISSTPRSNVVGQTEVFQGYGSASAFDSLEQTQSHRFTPRAECYCEPDVGENHADSKEMAREARRKLKEERQRKKERKRIKKARLEKECLSEKMNCFSHDNQHWRTAPLWNDSPFCFCMNANNNTYSCLRTINGTHNFLYCEFTTGLITFYNLTIDRFETINRAAGLTPGERSHMHDALDQLKSCRGRSCSIRRHQNHLEGGSSAPLLPINQVHRNNKRKHSPLAGAVGNYAFVGPRLDMEALPPIKRRKLSKYNRLTGSQQSHMKRRPWKQTPLQQSPRFLRTHSVTPAQA | ||||||
Modified residue | 98 | 3-oxoalanine (Cys) | ||||
Sequence: C | ||||||
Glycosylation | 122 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 159 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 181 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 208 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 251 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 447 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 683 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 713 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 743 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 817 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 945 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 955 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 974 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Post-translational modification
The conversion to 3-oxoalanine (also known as C-formylglycine, FGly), of a serine or cysteine residue in prokaryotes and of a cysteine residue in eukaryotes, is critical for catalytic activity.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 466-482 | Polar residues | ||||
Sequence: SSSSTAATLMSSTAQQP | ||||||
Region | 466-504 | Disordered | ||||
Sequence: SSSSTAATLMSSTAQQPEDGEEEVETDNEEDDVDGDGAM | ||||||
Compositional bias | 483-504 | Acidic residues | ||||
Sequence: EDGEEEVETDNEEDDVDGDGAM | ||||||
Region | 781-812 | Disordered | ||||
Sequence: KQLRESNKQALAAGRRNDNRRRNDQSVLDSGA | ||||||
Compositional bias | 876-891 | Basic and acidic residues | ||||
Sequence: ADSKEMAREARRKLKE | ||||||
Region | 876-901 | Disordered | ||||
Sequence: ADSKEMAREARRKLKEERQRKKERKR | ||||||
Region | 1073-1114 | Disordered | ||||
Sequence: LSKYNRLTGSQQSHMKRRPWKQTPLQQSPRFLRTHSVTPAQA | ||||||
Compositional bias | 1077-1114 | Polar residues | ||||
Sequence: NRLTGSQQSHMKRRPWKQTPLQQSPRFLRTHSVTPAQA |
Sequence similarities
Belongs to the sulfatase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length1,114
- Mass (Da)127,303
- Last updated2000-05-01 v1
- ChecksumFC14DD0975B3A096
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
D1Z367 | D1Z367_DROME | Sulf1 | 1114 |
Sequence caution
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 104-105 | in Ref. 4; AAF32278 | ||||
Sequence: SL → TR | ||||||
Compositional bias | 466-482 | Polar residues | ||||
Sequence: SSSSTAATLMSSTAQQP | ||||||
Compositional bias | 483-504 | Acidic residues | ||||
Sequence: EDGEEEVETDNEEDDVDGDGAM | ||||||
Sequence conflict | 655 | in Ref. 3; AAM50312 | ||||
Sequence: E → A | ||||||
Compositional bias | 876-891 | Basic and acidic residues | ||||
Sequence: ADSKEMAREARRKLKE | ||||||
Compositional bias | 1077-1114 | Polar residues | ||||
Sequence: NRLTGSQQSHMKRRPWKQTPLQQSPRFLRTHSVTPAQA |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE014297 EMBL· GenBank· DDBJ | AAF55296.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY119658 EMBL· GenBank· DDBJ | AAM50312.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AF211192 EMBL· GenBank· DDBJ | AAF32278.1 EMBL· GenBank· DDBJ | mRNA | Frameshift |