Q9VBV3 · TAKT_DROME
- ProteinProtein takeout
- Geneto
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids249 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Participates in a novel circadian output pathway that conveys temporal and food status information to feeding-relevant metabolisms and activities. Involved in male courtship behavior. In the brain-associated fat body, transcription is enhanced by the dsx and fru male-specific isoforms and repressed by the dsx female-specific isoform.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | extracellular space | |
Biological Process | adult feeding behavior | |
Biological Process | behavioral response to starvation | |
Biological Process | circadian rhythm | |
Biological Process | feeding behavior | |
Biological Process | male courtship behavior | |
Biological Process | mating behavior | |
Biological Process | response to starvation | |
Biological Process | rhythmic behavior |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProtein takeout
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ9VBV3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-18 | |||||
Sequence: MFAIAFAVVLCLLVSVDA | ||||||
Chain | PRO_0000022469 | 19-249 | Protein takeout | |||
Sequence: KFPEDPKPCKYGDGECIMKLCNTLFSENSAEGDPGLNLMQLDPLKVDRMVISQGESSSPVGITLTFTDNLLYGIKDQRIVKVKGFGRDLTAKHEVKIVTKTFSLVGPYNIQGKVLILPISGTGQSNMTMVNVRAIVSFSGKPLVKNGETYLDVTDLKITMKPESSHYHFSNLFNGDKALGDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFFADES |
Proteomic databases
Expression
Tissue specificity
Expression is largely restricted to head, with limited expression detectable in cardia and crop. In entrained individuals, expression is observed in the brain cortex (region between optic lobe and central complex), photoreceptors and antennae. In asynchronous individuals, expression is seen in third antennal segment and male-specific expression is seen in the brain-associated fat body.
Induction
Starvation and circadian clock. In the heads of entrained flies, levels fluctuate daily and the cycle phase is delayed with respect to per and tim. Cycling appears to be linked to the endogenous clock rather than light stimuli.
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length249
- Mass (Da)27,344
- Last updated2000-05-01 v1
- ChecksumCC3C8634310D5061
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0B4LHM9 | A0A0B4LHM9_DROME | to | 249 |
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF261748 EMBL· GenBank· DDBJ | AAF79960.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014297 EMBL· GenBank· DDBJ | AAF56425.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY122096 EMBL· GenBank· DDBJ | AAM52608.1 EMBL· GenBank· DDBJ | mRNA | Different initiation |