Q9VBI4 · Q9VBI4_DROME
- ProteinExocyst complex component 8
- GeneExo84
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids671 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | exocyst | |
Cellular Component | growth cone | |
Cellular Component | perinuclear region of cytoplasm | |
Cellular Component | presynapse | |
Biological Process | actomyosin contractile ring contraction | |
Biological Process | endocytic recycling | |
Biological Process | establishment or maintenance of cell polarity | |
Biological Process | Golgi to plasma membrane transport | |
Biological Process | maintenance of epithelial cell apical/basal polarity | |
Biological Process | meiosis I cytokinesis | |
Biological Process | meiosis II cytokinesis | |
Biological Process | meiotic spindle organization | |
Biological Process | neurotransmitter secretion | |
Biological Process | protein localization | |
Biological Process | protein localization to plasma membrane | |
Biological Process | protein transport | |
Biological Process | spermatid development | |
Biological Process | synaptic vesicle docking | |
Biological Process | synaptic vesicle targeting | |
Biological Process | vesicle-mediated transport |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameExocyst complex component 8
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ9VBI4
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 137-235 | PH | ||||
Sequence: TFLNEGALIELDSNDYRPIQRVFFFLFNDVLIVCKVKHDKRLDFLTEYDPKKIAVINIKDLDGVKNAINIITPDGSKIYQSITAAGKTEWIEKLEEAFR | ||||||
Region | 237-285 | Disordered | ||||
Sequence: DQQKKPKKGQAPQPPTRAKQQSKASTPEKETTPQSPGQPKSLEDETPEW | ||||||
Compositional bias | 250-285 | Polar residues | ||||
Sequence: PPTRAKQQSKASTPEKETTPQSPGQPKSLEDETPEW |
Sequence similarities
Belongs to the EXO84 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length671
- Mass (Da)76,531
- Last updated2000-05-01 v1
- Checksum1EDAAA4E7905D754
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q7KRZ3 | Q7KRZ3_DROME | Exo84 | 672 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 250-285 | Polar residues | ||||
Sequence: PPTRAKQQSKASTPEKETTPQSPGQPKSLEDETPEW |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE014297 EMBL· GenBank· DDBJ | AAF56558.1 EMBL· GenBank· DDBJ | Genomic DNA |