Q9VAJ3 · PPK19_DROME
- ProteinPickpocket protein 19
- Geneppk19
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids511 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Part of a complex that plays a role in tracheal liquid clearance. In both larvae and adults, contributes to the behavioral response to salt. Probable role in sodium transport.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Cellular Component | plasma membrane | |
Cellular Component | sodium channel complex | |
Molecular Function | ligand-gated sodium channel activity | |
Molecular Function | mechanosensitive monoatomic cation channel activity | |
Molecular Function | pH-gated monoatomic ion channel activity | |
Molecular Function | sodium channel activity | |
Biological Process | detection of chemical stimulus involved in sensory perception of pain | |
Biological Process | detection of mechanical stimulus involved in sensory perception of pain | |
Biological Process | liquid clearance, open tracheal system | |
Biological Process | response to salt stress | |
Biological Process | salt aversion | |
Biological Process | sensory perception of salty taste | |
Biological Process | sodium ion transmembrane transport |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePickpocket protein 19
- Short namesPPK19
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ9VAJ3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 59-79 | Helical | ||||
Sequence: LWLAIVLGAVITGFSLYTVLM | ||||||
Transmembrane | 471-491 | Helical | ||||
Sequence: GIISLYIGASVMSFIELLFVL |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000420126 | 1-511 | Pickpocket protein 19 | |||
Sequence: MLLYTKELVIPRPRPGLLRFRNNPRGIKFREKLCNSFAHSNIHGMQHVFGEQHLWQRCLWLAIVLGAVITGFSLYTVLMHRHSEQLLVSLIETTQLPVYHIDFPAVAVCPWNHFNWQRAPSAFIRFLPRHPNAELRETFRQLLASMDIMNFSNFNRIRILTKRNLTGISYLKMTDLMNFMTYRCDELFVADSCVFDETPYDCCKLFVREQTVKGQCLVFNSMISENSRKKHLINQFYPHKLSTAGEDSGLKFTINASYSFMNNIDALTPFGMNLMIKEPRQWSNEMMYHLYPDTENFVAVHPLVTETSPNTYEMSPKKRRCYFDDEKNPTFQNTSLTYNRENCLVVCLHLVVWKTCQCSLPAFLPPIDGVPECGINDAQCLGNNSDIFTYVKMGDQEKYINDSRQGHFCDCPDNCNSRLYEMSLNVRKLDYPKNSTDQLIKAQVYYGQRVMTKIITKLKYTNIDLLANFGGIISLYIGASVMSFIELLFVLGKLMWGFIRDARIKLKEYTK |
Proteomic databases
Expression
Tissue specificity
Expressed in the tracheal system. Expressed in the taste-sensing terminal organ of the larval head. In adults, expressed in hairs on the tibia, femur and wing margin, but not in hairs on the tarsi of the leg.
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Length511
- Mass (Da)59,461
- Last updated2005-04-26 v2
- ChecksumDF8668C68E5CCACA
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 112 | in Ref. 1; AAO47373 | ||||
Sequence: N → S | ||||||
Sequence conflict | 158 | in Ref. 1; AAO47373 | ||||
Sequence: R → L | ||||||
Sequence conflict | 230 | in Ref. 1; AAO47373 | ||||
Sequence: K → N | ||||||
Sequence conflict | 247 | in Ref. 1; AAO47373 | ||||
Sequence: D → E | ||||||
Sequence conflict | 259 | in Ref. 1; AAO47373 | ||||
Sequence: S → A | ||||||
Sequence conflict | 357 | in Ref. 1; AAO47373 | ||||
Sequence: Q → R | ||||||
Sequence conflict | 418 | in Ref. 1; AAO47373 | ||||
Sequence: R → Q |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY226547 EMBL· GenBank· DDBJ | AAO47373.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014297 EMBL· GenBank· DDBJ | AAF56913.2 EMBL· GenBank· DDBJ | Genomic DNA |