Q9V4K2 · GR43A_DROME
- ProteinGustatory receptor for sugar taste 43a
- GeneGr43a
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids427 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Gustatory receptor which mediates acceptance or avoidance behavior, depending on its substrates. Gr43a is the main sugar receptor in larvae. Functions as a narrowly tuned fructose receptor in taste neurons but also as a fructose receptor in the brain. Necessary and sufficient to sense hemolymph fructose and promote feeding in hungry flies but suppress feeding in satiated flies.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 70 | beta-D-fructose (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 83 | beta-D-fructose (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 182 | beta-D-fructose (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 310 | beta-D-fructose (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 337 | beta-D-fructose (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 421 | Ca2+ (UniProtKB | ChEBI) | ||||
Sequence: Q |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axon | |
Cellular Component | dendrite | |
Cellular Component | membrane | |
Cellular Component | neuronal cell body | |
Cellular Component | plasma membrane | |
Molecular Function | ionotropic sweet taste receptor activity | |
Molecular Function | ligand-gated monoatomic cation channel activity | |
Molecular Function | sweet taste receptor activity | |
Molecular Function | taste receptor activity | |
Biological Process | adult feeding behavior | |
Biological Process | cellular response to fructose stimulus | |
Biological Process | chemosensory behavior | |
Biological Process | male courtship behavior | |
Biological Process | monoatomic cation transmembrane transport | |
Biological Process | regulation of appetite | |
Biological Process | regulation of feeding behavior | |
Biological Process | sensory perception of sweet taste | |
Biological Process | sensory perception of taste | |
Biological Process | signal transduction |
Keywords
- Molecular function
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameGustatory receptor for sugar taste 43a
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ9V4K2
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-37 | Cytoplasmic | ||||
Sequence: MEISQPSIGIFYISKVLALAPYATVRNSKGRVEIGRS | ||||||
Transmembrane | 38-63 | Helical; Name=S1 | ||||
Sequence: WLFTVYSATLTVVMVFLTYRGLLFDA | ||||||
Topological domain | 64-75 | Extracellular | ||||
Sequence: NSEIPVRMKSAT | ||||||
Transmembrane | 76-96 | Helical; Name=S2 | ||||
Sequence: SKVVTALDVSVVVMAIVSGVY | ||||||
Topological domain | 97-135 | Cytoplasmic | ||||
Sequence: CGLFSLNDTLELNDRLNKIDNTLNAYNNFRRDRWRALGM | ||||||
Transmembrane | 136-158 | Helical; Name=S3 | ||||
Sequence: AAVSLLAISILVGLDVGTWMRIA | ||||||
Topological domain | 159-168 | Extracellular | ||||
Sequence: QDMNIAQSDT | ||||||
Transmembrane | 169-193 | Helical; Name=S4 | ||||
Sequence: ELNVHWYIPFYSLYFILTGLQVNIA | ||||||
Topological domain | 194-293 | Cytoplasmic | ||||
Sequence: NTAYGLGRRFGRLNRMLSSSFLAENNATSAIKPQKVSTVKNVSVNRPAMPSALHASLTKLNGETLPSEAAAKNKGLLLKSLADSHESLGKCVHLLSNSFG | ||||||
Transmembrane | 294-316 | Helical; Name=S5 | ||||
Sequence: IAVLFILVSCLLHLVATAYFLFL | ||||||
Topological domain | 317-324 | Extracellular | ||||
Sequence: ELLSKRDN | ||||||
Transmembrane | 325-346 | Helical; Name=S6 | ||||
Sequence: GYLWVQMLWICFHFLRLLMVVE | ||||||
Topological domain | 347-402 | Cytoplasmic | ||||
Sequence: PCHLAARESRKTIQIVCEIERKVHEPILAEAVKKFWQQLLVVDADFSACGLCRVNR | ||||||
Transmembrane | 403-423 | Helical; Name=S7b | ||||
Sequence: TILTSFASAIATYLVILIQFQ | ||||||
Topological domain | 424-427 | Extracellular | ||||
Sequence: RTNG |
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 70 | Significantly reduces fructose-induced current. | ||||
Sequence: R → A | ||||||
Mutagenesis | 83 | Abolishes fructose-induced current. | ||||
Sequence: D → A | ||||||
Mutagenesis | 150 | Abolishes fructose-induced current. | ||||
Sequence: D → A | ||||||
Mutagenesis | 182 | Abolishes fructose-induced current. | ||||
Sequence: Y → A | ||||||
Mutagenesis | 212 | No effect on fructose-induced current. | ||||
Sequence: S → A | ||||||
Mutagenesis | 266 | No effect on fructose-induced current. | ||||
Sequence: N → A | ||||||
Mutagenesis | 269 | No effect on fructose-induced current. | ||||
Sequence: L → A | ||||||
Mutagenesis | 286 | Increases conduit ion current amplitude significantly. | ||||
Sequence: H → W | ||||||
Mutagenesis | 306 | Significantly reduces fructose-induced current. | ||||
Sequence: H → A | ||||||
Mutagenesis | 310 | Abolishes fructose-induced current. | ||||
Sequence: T → A | ||||||
Mutagenesis | 333 | Abolishes fructose-induced current. | ||||
Sequence: W → A | ||||||
Mutagenesis | 337 | Abolishes fructose-induced current. | ||||
Sequence: H → A | ||||||
Mutagenesis | 353 | Reduces conduit ion current amplitude significantly. | ||||
Sequence: R → W | ||||||
Mutagenesis | 357 | Reduces conduit ion current amplitude significantly. | ||||
Sequence: K → W | ||||||
Mutagenesis | 360 | Reduces conduit ion current amplitude significantly. | ||||
Sequence: Q → W | ||||||
Mutagenesis | 389 | Reduces conduit ion current amplitude significantly. | ||||
Sequence: D → W | ||||||
Mutagenesis | 393 | Reduces conduit ion current amplitude significantly. | ||||
Sequence: S → W | ||||||
Mutagenesis | 418 | Results in constitutive activation of the channel pore that is further activated when fructose binds. | ||||
Sequence: I → A | ||||||
Mutagenesis | 421 | Complete loss of function. | ||||
Sequence: Q → A | ||||||
Mutagenesis | 421 | Low constitutive activity and loss of fructose sensitivity. | ||||
Sequence: Q → N | ||||||
Mutagenesis | 422 | Deactivation of central channel pore that does not reactivate upon fructose binding. | ||||
Sequence: F → A |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000216514 | 1-427 | Gustatory receptor for sugar taste 43a | |||
Sequence: MEISQPSIGIFYISKVLALAPYATVRNSKGRVEIGRSWLFTVYSATLTVVMVFLTYRGLLFDANSEIPVRMKSATSKVVTALDVSVVVMAIVSGVYCGLFSLNDTLELNDRLNKIDNTLNAYNNFRRDRWRALGMAAVSLLAISILVGLDVGTWMRIAQDMNIAQSDTELNVHWYIPFYSLYFILTGLQVNIANTAYGLGRRFGRLNRMLSSSFLAENNATSAIKPQKVSTVKNVSVNRPAMPSALHASLTKLNGETLPSEAAAKNKGLLLKSLADSHESLGKCVHLLSNSFGIAVLFILVSCLLHLVATAYFLFLELLSKRDNGYLWVQMLWICFHFLRLLMVVEPCHLAARESRKTIQIVCEIERKVHEPILAEAVKKFWQQLLVVDADFSACGLCRVNRTILTSFASAIATYLVILIQFQRTNG |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the adult labellar chemosensory neurons and in the adult head, abdomen, leg and wing. In larvae, is expressed in taste organs, as well as the brain and the gastrointestinal system.
Gene expression databases
Structure
Family & Domains
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length427
- Mass (Da)47,573
- Last updated2004-05-10 v3
- Checksum19928FBA374AABAB
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0B4LEE5 | A0A0B4LEE5_DROME | Gr43a | 453 | ||
Q0E9G8 | Q0E9G8_DROME | Gr43a | 449 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE013599 EMBL· GenBank· DDBJ | AAF59268.3 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT023089 EMBL· GenBank· DDBJ | AAY55505.1 EMBL· GenBank· DDBJ | mRNA |