Q9V422 · RYK2_DROME
- ProteinTyrosine-protein kinase Dnt
- Genednt
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids584 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
May play an essential role in neuronal pathway recognition and ventral muscle attachment site selection.
Catalytic activity
- ATP + L-tyrosyl-[protein] = ADP + H+ + O-phospho-L-tyrosyl-[protein]
Features
Showing features for binding site, active site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane | |
Cellular Component | receptor complex | |
Molecular Function | ATP binding | |
Molecular Function | protein heterodimerization activity | |
Biological Process | axon guidance | |
Biological Process | axonogenesis | |
Biological Process | determination of muscle attachment site | |
Biological Process | muscle attachment | |
Biological Process | salivary gland morphogenesis | |
Biological Process | signal transduction |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTyrosine-protein kinase Dnt
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ9V422
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 41-208 | Extracellular | ||||
Sequence: SEVAAHLNVFLNPVEVMRLLGVSAEVYYVREGHINNYALNFIVPVPANVKDISFTWQSLAGRGLPYSINVVSSDQEVLPRPAINVSHSGEIPTTIQTWSIALKCSGLKAAEVDVTVSLEVVLNRSLNNVTHLVFRRKKICLMNDSAEDLSEDVDDPQLLETVMLPPTG | ||||||
Transmembrane | 209-229 | Helical | ||||
Sequence: LITLVVGVSVAMGSVCLLLMI | ||||||
Topological domain | 230-584 | Cytoplasmic | ||||
Sequence: AYCVKGAANKRQHHQHGGQPMRTSSFQRLNTHPPCQSSMGSAAYMTPSIIAPIHGSSLPRKVPVSVEQQHPEELHRRISELTVERCRVRLSSLLQEGTFGRVYRGTYNDTQDVLVKTVAQHASQMQVLLLLQEGMLLYGASHPGILSVLGVSIEDHTTPFVLYPALNNTRNLKQFLLDPACARTVTTIQIVMMASQLSMALDHLHSHGVVHKDIATRNCVIDDQLRVKLSDSSLSRDLFPSDYNCLGDSENRPVKWMSLEALQHKQFSEASDSWAFGVLMWELCTSAKQPYAEVDPFEMEHYLKDGYRLAQPFNCPDELFTIMAYCWALLPAERPTFAQLQSCLSEFYSQITRYV |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, glycosylation, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-40 | |||||
Sequence: MESVNKCGKSASTRNCTVKMSRKMWVLSLLALAALQLHSG | ||||||
Chain | PRO_0000024467 | 41-584 | Tyrosine-protein kinase Dnt | |||
Sequence: SEVAAHLNVFLNPVEVMRLLGVSAEVYYVREGHINNYALNFIVPVPANVKDISFTWQSLAGRGLPYSINVVSSDQEVLPRPAINVSHSGEIPTTIQTWSIALKCSGLKAAEVDVTVSLEVVLNRSLNNVTHLVFRRKKICLMNDSAEDLSEDVDDPQLLETVMLPPTGLITLVVGVSVAMGSVCLLLMIAYCVKGAANKRQHHQHGGQPMRTSSFQRLNTHPPCQSSMGSAAYMTPSIIAPIHGSSLPRKVPVSVEQQHPEELHRRISELTVERCRVRLSSLLQEGTFGRVYRGTYNDTQDVLVKTVAQHASQMQVLLLLQEGMLLYGASHPGILSVLGVSIEDHTTPFVLYPALNNTRNLKQFLLDPACARTVTTIQIVMMASQLSMALDHLHSHGVVHKDIATRNCVIDDQLRVKLSDSSLSRDLFPSDYNCLGDSENRPVKWMSLEALQHKQFSEASDSWAFGVLMWELCTSAKQPYAEVDPFEMEHYLKDGYRLAQPFNCPDELFTIMAYCWALLPAERPTFAQLQSCLSEFYSQITRYV | ||||||
Glycosylation | 124 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 163 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 168 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 183 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Modified residue | 472 | Phosphotyrosine; by autocatalysis | ||||
Sequence: Y |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in dynamic domains in the embryonic epidermis, many of which border on sites of epithelial invagination into the embryo interior, including ventral furrow, cephalic furrow, fore- and hindgut, optic lobe and tracheal pits. Later in embryogenesis, expression is seen in imaginal tissues.
Developmental stage
Expressed both maternally and zygotically from embryos to adults. High expression is seen in embryos, pupae and adults (highest in early pupae) and low expression in larvae.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 49-180 | WIF | ||||
Sequence: VFLNPVEVMRLLGVSAEVYYVREGHINNYALNFIVPVPANVKDISFTWQSLAGRGLPYSINVVSSDQEVLPRPAINVSHSGEIPTTIQTWSIALKCSGLKAAEVDVTVSLEVVLNRSLNNVTHLVFRRKKIC | ||||||
Region | 241-261 | Disordered | ||||
Sequence: QHHQHGGQPMRTSSFQRLNTH | ||||||
Compositional bias | 247-261 | Polar residues | ||||
Sequence: GQPMRTSSFQRLNTH | ||||||
Domain | 317-577 | Protein kinase | ||||
Sequence: VRLSSLLQEGTFGRVYRGTYNDTQDVLVKTVAQHASQMQVLLLLQEGMLLYGASHPGILSVLGVSIEDHTTPFVLYPALNNTRNLKQFLLDPACARTVTTIQIVMMASQLSMALDHLHSHGVVHKDIATRNCVIDDQLRVKLSDSSLSRDLFPSDYNCLGDSENRPVKWMSLEALQHKQFSEASDSWAFGVLMWELCTSAKQPYAEVDPFEMEHYLKDGYRLAQPFNCPDELFTIMAYCWALLPAERPTFAQLQSCLSEFY |
Sequence similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length584
- Mass (Da)64,938
- Last updated2003-01-27 v2
- ChecksumF46FCD024BD8447E
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
M9PG69 | M9PG69_DROME | dnt | 584 |
Sequence caution
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 247-261 | Polar residues | ||||
Sequence: GQPMRTSSFQRLNTH | ||||||
Sequence conflict | 448 | in Ref. 5; AAX33387 | ||||
Sequence: C → Y |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ224361 EMBL· GenBank· DDBJ | CAA11918.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AF123572 EMBL· GenBank· DDBJ | AAD31179.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AE014134 EMBL· GenBank· DDBJ | AAF53783.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT021239 EMBL· GenBank· DDBJ | AAX33387.1 EMBL· GenBank· DDBJ | mRNA | ||
BT057997 EMBL· GenBank· DDBJ | ACM16707.1 EMBL· GenBank· DDBJ | mRNA | ||
AY058760 EMBL· GenBank· DDBJ | AAL13989.1 EMBL· GenBank· DDBJ | mRNA |