Q9UNN5 · FAF1_HUMAN
- ProteinFAS-associated factor 1
- GeneFAF1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids650 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Ubiquitin-binding protein (PubMed:19722279).
Required for the progression of DNA replication forks by targeting DNA replication licensing factor CDT1 for degradation (PubMed:26842564).
Potentiates but cannot initiate FAS-induced apoptosis (By similarity).
Required for the progression of DNA replication forks by targeting DNA replication licensing factor CDT1 for degradation (PubMed:26842564).
Potentiates but cannot initiate FAS-induced apoptosis (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameFAS-associated factor 1
- Short nameshFAF1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9UNN5
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 547 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000211038 | 1-650 | UniProt | FAS-associated factor 1 | |||
Sequence: MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGETIPGPAFNPASHPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFMLIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGWPTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEEQITDVHMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTAQQQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLEQIRKEQEEEREAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE | |||||||
Modified residue (large scale data) | 269 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 270 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 320 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 320 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 556 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 580 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 580 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 582 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 582 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Most abundant in testis, slightly less abundant in skeletal muscle and heart, followed by prostate, thymus, ovary, small intestine, and colon. Not detected in the peripheral blood leukocytes.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with CDT1 and ATPase VCP/p97 (PubMed:26842564).
Interacts (via UBA domain) with FAS (via death domain) (PubMed:10462485).
Interacts (via UBA domain) with NLRP12 (via DAPIN/PYRIN domain) (PubMed:21978668).
Interacts (via UBA domain) with FAS (via death domain) (PubMed:10462485).
Interacts (via UBA domain) with NLRP12 (via DAPIN/PYRIN domain) (PubMed:21978668).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9UNN5 | GRN P28799 | 3 | EBI-718246, EBI-747754 | |
BINARY | Q9UNN5 | SPRED1 Q7Z699 | 3 | EBI-718246, EBI-5235340 | |
BINARY | Q9UNN5 | VCP P55072 | 3 | EBI-718246, EBI-355164 | |
BINARY | Q9UNN5 | YTHDF3 Q7Z739 | 3 | EBI-718246, EBI-2849837 | |
BINARY | Q9UNN5-1 | VCP P55072 | 4 | EBI-15930546, EBI-355164 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-57 | UBA | ||||
Sequence: MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYG | ||||||
Region | 62-87 | Disordered | ||||
Sequence: PGPAFNPASHPASAPTSSSSSAFRPV | ||||||
Compositional bias | 71-87 | Polar residues | ||||
Sequence: HPASAPTSSSSSAFRPV | ||||||
Domain | 569-646 | UBX | ||||
Sequence: NAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFL |
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9UNN5-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameLong
- Length650
- Mass (Da)73,954
- Last updated2002-05-02 v2
- Checksum7FB9018B9A230488
Q9UNN5-2
- NameShort
- SynonymshFAF1(s)
- Differences from canonical
- 188-339: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
B3KT28 | B3KT28_HUMAN | FAF1 | 464 |
Sequence caution
Features
Showing features for compositional bias, alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 71-87 | Polar residues | ||||
Sequence: HPASAPTSSSSSAFRPV | ||||||
Alternative sequence | VSP_006704 | 188-339 | in isoform Short | |||
Sequence: Missing | ||||||
Sequence conflict | 448 | in Ref. 1; AAD51886/AAD51876 | ||||
Sequence: F → K | ||||||
Sequence conflict | 498 | in Ref. 1; AAD51886/AAD51876 | ||||
Sequence: E → G | ||||||
Sequence conflict | 529 | in Ref. 1; AAD51886/AAD51876 | ||||
Sequence: H → R |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF106798 EMBL· GenBank· DDBJ | AAD51886.1 EMBL· GenBank· DDBJ | mRNA | ||
AF094700 EMBL· GenBank· DDBJ | AAD51876.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AF136173 EMBL· GenBank· DDBJ | AAP97263.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ271408 EMBL· GenBank· DDBJ | CAB67705.1 EMBL· GenBank· DDBJ | mRNA | ||
AF132938 EMBL· GenBank· DDBJ | AAD27713.1 EMBL· GenBank· DDBJ | mRNA | ||
AC091610 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC118557 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL049637 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL359977 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL603746 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471059 EMBL· GenBank· DDBJ | EAX06837.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC004970 EMBL· GenBank· DDBJ | AAH04970.1 EMBL· GenBank· DDBJ | mRNA | ||
BC067100 EMBL· GenBank· DDBJ | AAH67100.1 EMBL· GenBank· DDBJ | mRNA | ||
AL133631 EMBL· GenBank· DDBJ | CAB63755.1 EMBL· GenBank· DDBJ | mRNA |