Q9ULJ8 · NEB1_HUMAN
- ProteinNeurabin-1
- GenePPP1R9A
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1098 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Binds to actin filaments (F-actin) and shows cross-linking activity. Binds along the sides of the F-actin. May be involved in neurite formation. Inhibits protein phosphatase 1-alpha activity (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | actin cytoskeleton | |
Cellular Component | cortical actin cytoskeleton | |
Cellular Component | cytoplasm | |
Cellular Component | dendrite | |
Cellular Component | dendritic spine | |
Cellular Component | filopodium | |
Cellular Component | postsynaptic density | |
Molecular Function | actin filament binding | |
Biological Process | actin filament organization | |
Biological Process | calcium-mediated signaling | |
Biological Process | modulation of chemical synaptic transmission | |
Biological Process | neuron projection development |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNeurabin-1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9ULJ8
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | ||
---|---|---|---|---|---|
Natural variant | VAR_051746 | 331 | in dbSNP:rs10230714 | ||
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1,389 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | ||
---|---|---|---|---|---|---|
Chain | PRO_0000071507 | 1-1098 | UniProt | Neurabin-1 | ||
Modified residue (large scale data) | 131 | PRIDE | Phosphotyrosine | |||
Modified residue (large scale data) | 160 | PRIDE | Phosphoserine | |||
Modified residue (large scale data) | 180 | PRIDE | Phosphoserine | |||
Modified residue (large scale data) | 184 | PRIDE | Phosphoserine | |||
Modified residue (large scale data) | 185 | PRIDE | Phosphothreonine | |||
Modified residue (large scale data) | 187 | PRIDE | Phosphoserine | |||
Modified residue (large scale data) | 190 | PRIDE | Phosphoserine | |||
Modified residue | 192 | UniProt | Phosphoserine | |||
Modified residue (large scale data) | 199 | PRIDE | Phosphoserine | |||
Modified residue (large scale data) | 214 | PRIDE | Phosphoserine | |||
Modified residue (large scale data) | 228 | PRIDE | Phosphotyrosine | |||
Modified residue (large scale data) | 288 | PRIDE | Phosphoserine | |||
Modified residue (large scale data) | 291 | PRIDE | Phosphoserine | |||
Modified residue | 312 | UniProt | Phosphothreonine | |||
Modified residue (large scale data) | 334 | PRIDE | Phosphoserine | |||
Modified residue | 338 | UniProt | Phosphoserine | |||
Modified residue (large scale data) | 338 | PRIDE | Phosphoserine | |||
Modified residue (large scale data) | 341 | PRIDE | Phosphoserine | |||
Modified residue | 371 | UniProt | Phosphoserine | |||
Modified residue (large scale data) | 371 | PRIDE | Phosphoserine | |||
Modified residue (large scale data) | 378 | PRIDE | Phosphoserine | |||
Modified residue | 460 | UniProt | Phosphoserine; by PKA | |||
Modified residue (large scale data) | 839 | PRIDE | Phosphothreonine | |||
Modified residue | 840 | UniProt | Phosphoserine | |||
Modified residue (large scale data) | 840 | PRIDE | Phosphoserine | |||
Modified residue (large scale data) | 909 | PRIDE | Phosphoserine | |||
Modified residue | 915 | UniProt | Phosphoserine | |||
Modified residue (large scale data) | 915 | PRIDE | Phosphoserine | |||
Modified residue | 928 | UniProt | Phosphoserine | |||
Modified residue | 956 | UniProt | Phosphoserine | |||
Modified residue | 957 | UniProt | Phosphoserine | |||
Modified residue | 960 | UniProt | Phosphoserine | |||
Modified residue | 974 | UniProt | Phosphoserine | |||
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Possibly exists as a homodimer, homotrimer or a homotetramer. Interacts with F-actin, protein phosphatase 1 (PP1), neurabin-2 and p70-S6K (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | IntAct | |
---|---|---|---|---|---|
BINARY | Q9ULJ8 | RGS2 P41220 | 3 | EBI-2515561, EBI-712388 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain, coiled coil.
Type | ID | Position(s) | Description | ||
---|---|---|---|---|---|
Compositional bias | 1-28 | Polar residues | |||
Region | 1-66 | Disordered | |||
Region | 1-144 | Actin-binding | |||
Compositional bias | 31-53 | Basic and acidic residues | |||
Region | 87-117 | Disordered | |||
Compositional bias | 97-111 | Basic and acidic residues | |||
Compositional bias | 147-170 | Basic and acidic residues | |||
Region | 147-213 | Disordered | |||
Compositional bias | 174-213 | Polar residues | |||
Region | 251-395 | Disordered | |||
Compositional bias | 279-295 | Polar residues | |||
Region | 425-502 | Interaction with protein phosphatase 1 | |||
Domain | 504-592 | PDZ | |||
Coiled coil | 597-627 | ||||
Region | 597-1090 | Interaction with TGN38 | |||
Region | 627-647 | Disordered | |||
Compositional bias | 628-645 | Acidic residues | |||
Coiled coil | 670-824 | ||||
Region | 839-865 | Disordered | |||
Compositional bias | 851-865 | Polar residues | |||
Region | 888-952 | Disordered | |||
Compositional bias | 922-939 | Polar residues | |||
Domain | 988-1051 | SAM | |||
Coiled coil | 1033-1090 | ||||
Compositional bias | 1051-1087 | Basic and acidic residues | |||
Region | 1051-1098 | Disordered | |||
Domain
Interacts with p70-S6K via its PDZ domain.
The PP1 binding region is natively unstructured, upon PP1 binding, it acquires structure, blocks a substrate-binding site, and restricts PP1 phosphatase specificity to a subset of substrates.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 5 isoforms produced by Alternative splicing.
Q9ULJ8-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsLong
- Length1,098
- Mass (Da)123,342
- Last updated2004-07-19 v2
- MD5 Checksum0F89A3CA86591B2DEE5ABC332AF043E5
Q9ULJ8-2
- Name2
- SynonymsShort
- Differences from canonical
- 1-918: MLKTESSGERTTLRSASPHRNAYRTEFQALKSTFDKPKSDGEQKTKEGEGSQQSRGRKYGSNVNRIKNLFMQMGMEPNENAAVIAKTRGKGGHSSPQRRMKPKEFLEKTDGSVVKLESSVSERISRFDTMYDGPSYSKFTETRKMFERSVHESGQNNRYSPKKEKAGGSEPQDEWGGSKSNRGSTDSLDSLSSRTEAVSPTVSQLSAVFENTDSPSAIISEKAENNEYSVTGHYPLNLPSVTVTNLDTFGHLKDSNSWPPSNKRGVDTEDAHKSNATPVPEVASKSTSLASIPGEEIQQSKEPEDSTSNQQTPDSIDKDGPEEPCAESKAMPKSEIPSPQSQLLEDAEANLVGREAAKQQRKELAGGDFTSPDASASSCGKEVPEDSNNFDGSHVYMHSDYNVYRVRSRYNSDWGETGTEQDEEEDSDENSYYQPDMEYSEIVGLPEEEEIPANRKIKFSSAPIKVFNTYSNEDYDRRNDEVDPVAASAEYELEKRVEKLELFPVELEKDEDGLGISIIGMGVGADAGLEKLGIFVKTVTEGGAAQRDGRIQVNDQIVEVDGISLVGVTQNFAATVLRNTKGNVRFVIGREKPGQVSEVAQLISQTLEQERRQRELLEQHYAQYDADDDETGEYATDEEEDEVGPVLPGSDMAIEVFELPENEDMFSPSELDTSKLSHKFKELQIKHAVTEAEIQKLKTKLQAAENEKVRWELEKTQLQQNIEENKERMLKLESYWIEAQTLCHTVNEHLKETQSQYQALEKKYNKAKKLIKDFQQKELDFIKRQEAERKKIEDLEKAHLVEVQGLQVRIRDLEAEVFRLLKQNGTQVNNNNNIFERRTSLGEVSKGDTMENLDGKQTSCQDGLSQDLNEAVPETERLDSKALKTRAQLSVKNRRQRPSRTRLYDSVSSTDGEDSLER → MHITKLLPPKGLRTSSPESDSGVPPLTPVDSNVPFSSDHIAEFQEEPLDPEMGPLSSMWGDTSLFSTSKSDHDVEESPCHHQTTNKKILREKDDAKDPKSLRASSSLAVQGGKIKRKFVDLGAPLRRNSSKGKKWKEKEKEASRFSAGSRIFRGRLENWTPKPCSTAQTSTRSPCMPFSWFNDSRKGSYSFRNLPAPTSSLQPSPETLISDKKGS
- 960-967: Missing
Q9ULJ8-3
- Name3
- Differences from canonical
- 630-630: E → ENTVAELQGMSGNCNNNNNYFLK
- 919-919: K → KPSNSFYNHMHITKLLPPKGLRTSSPESDSGVPPLTPVDSNVPFSSDHIAEFQEEPLDPEMGPLSSMWGDTSLFSTSKSDHDVEESPCHHQTTNKKILREKDDAKDPKSLRASSSLAVQGGKIKRKFVDLGAPLRRNSSKGKKWKEKEKEASRFSAGSRIFRGRLENWTPKPCSTAQTSTRSPCMPFSWFNDSRKGSYSFRNLPAPTSSLQPSPETLISDKKGSKVENTWITKANKRNPNPSSSSIFGRHSQLMSVVWIQETN
- 960-967: Missing
Q9ULJ8-4
- Name4
- Differences from canonical
- 920-1028: NFTFNDDFSPSSTSSADLSGLGAEPKTPGLSQSLALSSDESLDMIDDEILDDGQSPKHSQCQNRAVQEWSVQQVSHWLMSLNLEQYVSEFSAQNITGEQLLQLDGNKLK → PSNSFYNHMHITKLLPPKGLRTSSPESDSGVPPLTPVDSNVPFSSDHIAEFQEEPLDPEMGPLSSMWGDTSLFSTSKSDHDVEESPCHHQTTNKKILREKDDAKDPKSLRASSSLAVQGGKIKRKFVDLGAPLRRNSSKGKKWKEKEKEASRFSAGSRIFRGRLENWTPKPCSTAQTSTRSPCMPFSWFNDSRKGSYSFRNLPAPTSSLQPSPETLISDKKGSKNFTFNDDFSPSSTSSADLSGLGAEPKTPGLSQSLALSSDE
Q9ULJ8-5
- Name5
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Features
Showing features for compositional bias, alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | ||
---|---|---|---|---|---|
Compositional bias | 1-28 | Polar residues | |||
Alternative sequence | VSP_011139 | 1-918 | in isoform 2 | ||
Compositional bias | 31-53 | Basic and acidic residues | |||
Compositional bias | 97-111 | Basic and acidic residues | |||
Compositional bias | 147-170 | Basic and acidic residues | |||
Compositional bias | 174-213 | Polar residues | |||
Compositional bias | 279-295 | Polar residues | |||
Sequence conflict | 379 | in Ref. 3; AAI50637 | |||
Compositional bias | 628-645 | Acidic residues | |||
Alternative sequence | VSP_044469 | 630 | in isoform 3 | ||
Compositional bias | 851-865 | Polar residues | |||
Alternative sequence | VSP_044470 | 919 | in isoform 3 | ||
Alternative sequence | VSP_053808 | 919 | in isoform 5 | ||
Alternative sequence | VSP_044471 | 920-1028 | in isoform 4 | ||
Compositional bias | 922-939 | Polar residues | |||
Sequence conflict | 952 | in Ref. 1; BAA90928 | |||
Alternative sequence | VSP_005121 | 960-967 | in isoform 2, isoform 3 and isoform 5 | ||
Sequence conflict | 1017 | In isoform Q9ULJ8-4; in Ref. 3; AAI30450 | |||
Sequence conflict | 1039 | In isoform Q9ULJ8-3; in Ref. 3; AAI50637 | |||
Compositional bias | 1051-1087 | Basic and acidic residues | |||
Sequence conflict | 1057 | In isoform Q9ULJ8-4; in Ref. 3; AAI30450 | |||
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK000075 EMBL· GenBank· DDBJ | BAA90928.1 EMBL· GenBank· DDBJ | mRNA | ||
AC002429 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC004022 EMBL· GenBank· DDBJ | AAC35294.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC073886 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC073890 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC130449 EMBL· GenBank· DDBJ | AAI30450.1 EMBL· GenBank· DDBJ | mRNA | ||
BC150636 EMBL· GenBank· DDBJ | AAI50637.1 EMBL· GenBank· DDBJ | mRNA | ||
AB033048 EMBL· GenBank· DDBJ | BAA86536.1 EMBL· GenBank· DDBJ | mRNA |