Q9UL33 · TPC2L_HUMAN
- ProteinTrafficking protein particle complex subunit 2-like protein
- GeneTRAPPC2L
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids140 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a role in vesicular transport from endoplasmic reticulum to Golgi.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | intracellular membrane-bounded organelle | |
Cellular Component | nucleus | |
Cellular Component | perinuclear region of cytoplasm | |
Cellular Component | TRAPP complex | |
Cellular Component | TRAPPII protein complex | |
Cellular Component | TRAPPIII protein complex | |
Biological Process | COPII vesicle coating | |
Biological Process | endoplasmic reticulum to Golgi vesicle-mediated transport | |
Biological Process | vesicle coating | |
Biological Process | vesicle tethering |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTrafficking protein particle complex subunit 2-like protein
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9UL33
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Encephalopathy, progressive, early-onset, with episodic rhabdomyolysis (PEERB)
- Note
- DescriptionAn autosomal recessive disease characterized by progressive encephalopathy exacerbated by febrile illness and associated with severe neurodevelopmental delay, episodes of rhabdomyolysis, developmental regression, epilepsy and tetraplegia.
- See alsoMIM:618331
Natural variants in PEERB
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_081978 | 37 | D>Y | in PEERB; altered intracellular trafficking from the ER to the Golgi to the plasma membrane; dbSNP:rs766510287 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_081978 | 37 | in PEERB; altered intracellular trafficking from the ER to the Golgi to the plasma membrane; dbSNP:rs766510287 | |||
Sequence: D → Y |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 227 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000294451 | 1-140 | Trafficking protein particle complex subunit 2-like protein | |||
Sequence: MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVYGYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIQSSRAFDNMVTSMMIQVC |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in testis, liver, bladder, lung, spleen and brain, several cell lines and primary chondrocytes cell line.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Component of the multisubunit TRAPP (transport protein particle) complex, which includes at least TRAPPC2, TRAPPC2L, TRAPPC3, TRAPPC3L, TRAPPC4, TRAPPC5, TRAPPC8, TRAPPC9, TRAPPC10, TRAPPC11 and TRAPPC12. Interacts with the heterodimer TRAPPC3-TRAPPC6A. Interacts with TRAPPC6A.
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9UL33-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length140
- Mass (Da)16,146
- Last updated2000-05-01 v1
- Checksum4549BCA7CE9566DC
Q9UL33-2
- Name2
- Differences from canonical
- 125-125: Missing
Computationally mapped potential isoform sequences
There are 8 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
H3BUK6 | H3BUK6_HUMAN | TRAPPC2L | 109 | ||
H3BQQ8 | H3BQQ8_HUMAN | TRAPPC2L | 129 | ||
H3BPN3 | H3BPN3_HUMAN | TRAPPC2L | 75 | ||
H3BPE0 | H3BPE0_HUMAN | TRAPPC2L | 37 | ||
H3BPS1 | H3BPS1_HUMAN | TRAPPC2L | 59 | ||
H3BP13 | H3BP13_HUMAN | TRAPPC2L | 241 | ||
A0A0B4J286 | A0A0B4J286_HUMAN | TRAPPC2L | 109 | ||
A0A0B4J294 | A0A0B4J294_HUMAN | TRAPPC2L | 146 |
Sequence caution
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_026641 | 125 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF089106 EMBL· GenBank· DDBJ | AAF00568.1 EMBL· GenBank· DDBJ | mRNA | ||
AF161524 EMBL· GenBank· DDBJ | AAF29139.1 EMBL· GenBank· DDBJ | mRNA | ||
AK126779 EMBL· GenBank· DDBJ | BAC86686.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
AK311885 EMBL· GenBank· DDBJ | BAG34826.1 EMBL· GenBank· DDBJ | mRNA | ||
AC092384 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC011369 EMBL· GenBank· DDBJ | AAH11369.1 EMBL· GenBank· DDBJ | mRNA | ||
BC018024 EMBL· GenBank· DDBJ | AAH18024.1 EMBL· GenBank· DDBJ | mRNA | ||
BC105809 EMBL· GenBank· DDBJ | AAI05810.1 EMBL· GenBank· DDBJ | mRNA |