Q9UKI9 · PO2F3_HUMAN
- ProteinPOU domain, class 2, transcription factor 3
- GenePOU2F3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids436 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3') and regulates cell type-specific differentiation pathways. Involved in the regulation of keratinocytes differentiation (PubMed:11329378).
The POU2F3-POU2AF2/POU2AF3 complex drives the expression of tuft-cell-specific genes, a rare chemosensory cells that coordinate immune and neural functions within mucosal epithelial tissues (PubMed:35576971).
The POU2F3-POU2AF2/POU2AF3 complex drives the expression of tuft-cell-specific genes, a rare chemosensory cells that coordinate immune and neural functions within mucosal epithelial tissues (PubMed:35576971).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 281-340 | Homeobox | ||||
Sequence: KRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRIN |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | cytosol | |
Cellular Component | nuclear body | |
Cellular Component | nucleolus | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | plasma membrane | |
Cellular Component | transcription regulator complex | |
Molecular Function | DNA-binding transcription activator activity, RNA polymerase II-specific | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | identical protein binding | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Molecular Function | sequence-specific DNA binding | |
Molecular Function | sequence-specific double-stranded DNA binding | |
Biological Process | epidermis development | |
Biological Process | keratinocyte differentiation | |
Biological Process | negative regulation by host of viral transcription | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of transcription by RNA polymerase II | |
Biological Process | wound healing |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePOU domain, class 2, transcription factor 3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9UKI9
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_031618 | 152 | in dbSNP:rs7110845 | |||
Sequence: H → R | ||||||
Natural variant | VAR_055906 | 390 | in dbSNP:rs2282537 | |||
Sequence: R → K |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 517 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000100717 | 1-436 | UniProt | POU domain, class 2, transcription factor 3 | |||
Sequence: MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQPGQQGLQPNLLPFPQQQSGLLLPQTGPGLASQAFGHPGLPGSSLEPHLEASQHLPVPKHLPSSGGADEPSDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAESSPSDPSVSTPSSYPSLSEVFGRKRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPIKPPVYNSRLVSPSGSLGPLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSFNSSGSWYRWNHSTYLH | |||||||
Modified residue (large scale data) | 238 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 286 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 287 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Tissue specificity
Specifically expressed in epidermis and cultured keratinocytes.
Gene expression databases
Organism-specific databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-40 | Disordered | ||||
Sequence: MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLD | ||||||
Compositional bias | 19-35 | Polar residues | ||||
Sequence: DSTDARSTLSQVEPGND | ||||||
Region | 140-186 | Disordered | ||||
Sequence: QTGPGLASQAFGHPGLPGSSLEPHLEASQHLPVPKHLPSSGGADEPS | ||||||
Domain | 183-257 | POU-specific | ||||
Sequence: DEPSDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAE | ||||||
Region | 256-278 | Disordered | ||||
Sequence: AESSPSDPSVSTPSSYPSLSEVF | ||||||
Compositional bias | 257-274 | Polar residues | ||||
Sequence: ESSPSDPSVSTPSSYPSL | ||||||
Region | 363-421 | Disordered | ||||
Sequence: LGPLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSFN | ||||||
Compositional bias | 373-421 | Polar residues | ||||
Sequence: STMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSFN |
Sequence similarities
Belongs to the POU transcription factor family. Class-2 subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q9UKI9-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsSkn-1a
- Length436
- Mass (Da)47,432
- Last updated2010-11-02 v3
- ChecksumCFF7F0153F0B7589
Q9UKI9-2
- Name2
- Differences from canonical
- 1-9: MVNLESMHT → MESPRTAKGGR
Q9UKI9-3
- Name3
- SynonymsSkn-1n
- Differences from canonical
- 1-9: MVNLESMHT → MNDAK
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Features
Showing features for alternative sequence, sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_043900 | 1-9 | in isoform 2 | |||
Sequence: MVNLESMHT → MESPRTAKGGR | ||||||
Alternative sequence | VSP_043901 | 1-9 | in isoform 3 | |||
Sequence: MVNLESMHT → MNDAK | ||||||
Sequence conflict | 6 | in Ref. 3; CAB45383 | ||||
Sequence: S → P | ||||||
Compositional bias | 19-35 | Polar residues | ||||
Sequence: DSTDARSTLSQVEPGND | ||||||
Sequence conflict | 37 | in Ref. 2; AAD55245 | ||||
Sequence: N → K | ||||||
Compositional bias | 257-274 | Polar residues | ||||
Sequence: ESSPSDPSVSTPSSYPSL | ||||||
Sequence conflict | 351 | in Ref. 1; AAF00199 | ||||
Sequence: V → D | ||||||
Compositional bias | 373-421 | Polar residues | ||||
Sequence: STMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSFN |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF162278 EMBL· GenBank· DDBJ | AAF00199.1 EMBL· GenBank· DDBJ | mRNA | ||
AF133895 EMBL· GenBank· DDBJ | AAD55245.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ012214 EMBL· GenBank· DDBJ | CAB45383.1 EMBL· GenBank· DDBJ | mRNA | ||
AK291993 EMBL· GenBank· DDBJ | BAF84682.1 EMBL· GenBank· DDBJ | mRNA | ||
AK302212 EMBL· GenBank· DDBJ | BAG63569.1 EMBL· GenBank· DDBJ | mRNA | ||
AP000679 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AP001150 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC101649 EMBL· GenBank· DDBJ | AAI01650.1 EMBL· GenBank· DDBJ | mRNA |