Q9UIR0 · BTNL2_HUMAN
- ProteinButyrophilin-like protein 2
- GeneBTNL2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids482 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Negative regulator of T-cell proliferation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | external side of plasma membrane | |
Cellular Component | plasma membrane | |
Molecular Function | signaling receptor binding | |
Biological Process | regulation of cytokine production | |
Biological Process | T cell receptor signaling pathway |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameButyrophilin-like protein 2
- Short namesBTL-II
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9UIR0
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-6 | Cytoplasmic | ||||
Sequence: MVDFPG | ||||||
Transmembrane | 7-23 | Helical; Signal-anchor for type II membrane protein | ||||
Sequence: YNLSGAVASFLFILLTM | ||||||
Topological domain | 24-482 | Extracellular | ||||
Sequence: KQSEDFRVIGPAHPILAGVGEDALLTCQLLPKRTTMHVEVRWYRSEPSTPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNGQYWCHFQDGNYCGETSLLLKVAGLGSAPSIHMEGPGESGVQLVCTARGWFPEPQVYWEDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRNASAESVSCLVHNPVLTEEKGSVISLPEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISIPFLGEEKIATFSLSESRMTFLWKTLLVWGLLLAVAVGLPRKRS |
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Sarcoidosis 2 (SS2)
- Note
- DescriptionAn idiopathic, systemic, inflammatory disease characterized by the formation of immune granulomas in involved organs. Granulomas predominantly invade the lungs and the lymphatic system, but also skin, liver, spleen, eyes and other organs may be involved.
- See alsoMIM:612387
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_033602 | 94 | in dbSNP:rs28362682 | |||
Sequence: W → R | ||||||
Natural variant | VAR_061307 | 181 | in dbSNP:rs28362681 | |||
Sequence: R → Q | ||||||
Natural variant | VAR_049837 | 188 | in dbSNP:rs9461742 | |||
Sequence: V → M | ||||||
Natural variant | VAR_021171 | 196 | in dbSNP:rs2076523 | |||
Sequence: K → E | ||||||
Natural variant | VAR_061308 | 202 | in dbSNP:rs28362680 | |||
Sequence: A → V | ||||||
Natural variant | VAR_033603 | 283 | in dbSNP:rs34423804 | |||
Sequence: D → V | ||||||
Natural variant | VAR_029128 | 334 | in dbSNP:rs28362679 | |||
Sequence: S → L | ||||||
Natural variant | VAR_033604 | 352 | in dbSNP:rs35037492 | |||
Sequence: A → T | ||||||
Natural variant | VAR_049838 | 360 | in dbSNP:rs2076530 | |||
Sequence: S → G | ||||||
Natural variant | VAR_033605 | 379 | in dbSNP:rs28362678 | |||
Sequence: P → L | ||||||
Natural variant | VAR_033606 | 380 | in dbSNP:rs28362677 | |||
Sequence: M → I | ||||||
Natural variant | VAR_033607 | 393 | in dbSNP:rs41521946 | |||
Sequence: P → Q |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 840 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000014537 | 1-482 | Butyrophilin-like protein 2 | |||
Sequence: MVDFPGYNLSGAVASFLFILLTMKQSEDFRVIGPAHPILAGVGEDALLTCQLLPKRTTMHVEVRWYRSEPSTPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNGQYWCHFQDGNYCGETSLLLKVAGLGSAPSIHMEGPGESGVQLVCTARGWFPEPQVYWEDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRNASAESVSCLVHNPVLTEEKGSVISLPEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISIPFLGEEKIATFSLSESRMTFLWKTLLVWGLLLAVAVGLPRKRS | ||||||
Disulfide bond | 50↔124 | |||||
Sequence: CQLLPKRTTMHVEVRWYRSEPSTPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNGQYWC | ||||||
Disulfide bond | 164↔218 | |||||
Sequence: CTARGWFPEPQVYWEDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRNASAESVSC | ||||||
Glycosylation | 210 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 267↔341 | |||||
Sequence: CYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRC | ||||||
Glycosylation | 427 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in brain, heart, kidney, liver, pancreas, ovary, leukocyte, small intestine, testis and thymus.
Induction
By pro-inflammatory cytokines such as TNF and IL1B/interleukin-1 beta.
Gene expression databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9UIR0-4 | OPTN Q96CV9 | 3 | EBI-25911105, EBI-748974 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 29-140 | Ig-like V-type 1 | ||||
Sequence: FRVIGPAHPILAGVGEDALLTCQLLPKRTTMHVEVRWYRSEPSTPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNGQYWCHFQDGNYCGETSLLLK | ||||||
Domain | 142-234 | Ig-like V-type 2 | ||||
Sequence: AGLGSAPSIHMEGPGESGVQLVCTARGWFPEPQVYWEDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRNASAESVSCLVHNPVLTEEKGSVIS | ||||||
Domain | 236-355 | Ig-like V-type 3 | ||||
Sequence: PEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLD |
Sequence similarities
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 6 isoforms produced by Alternative splicing.
Q9UIR0-7
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name7
- Length482
- Mass (Da)53,517
- Last updated2024-01-24 v2
- Checksum0AF4BC1960F43198
Q9UIR0-1
- Name1
Q9UIR0-2
- Name2
- SynonymsLong
- Differences from canonical
- 143-236: Missing
Q9UIR0-3
- Name3
- SynonymsShort
Q9UIR0-4
- Name4
Q9UIR0-8
- Name8
- NoteMay be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Computationally mapped potential isoform sequences
There are 7 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
X5D146 | X5D146_HUMAN | BTNL2 | 455 | ||
F6UPS5 | F6UPS5_HUMAN | BTNL2 | 108 | ||
F8WDK6 | F8WDK6_HUMAN | BTNL2 | 68 | ||
A0AAG2RJY6 | A0AAG2RJY6_HUMAN | BTNL2 | 178 | ||
A0A0G2JPB7 | A0A0G2JPB7_HUMAN | BTNL2 | 455 | ||
A0A0G2JME2 | A0A0G2JME2_HUMAN | BTNL2 | 178 | ||
A0A0G2JJ84 | A0A0G2JJ84_HUMAN | BTNL2 | 482 |
Sequence caution
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 27 | in Ref. 6; AAV91023 | ||||
Sequence: Missing | ||||||
Alternative sequence | VSP_062051 | 28-237 | in isoform 4 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_062052 | 63-71 | in isoform 8 | |||
Sequence: VRWYRSEPS → RNSRLSWLL | ||||||
Alternative sequence | VSP_062053 | 72-482 | in isoform 8 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_062054 | 143-236 | in isoform 2 and isoform 3 | |||
Sequence: Missing | ||||||
Sequence conflict | 150 | In isoform Q9UIR0-4; in Ref. 5; AAI27643 | ||||
Sequence: S → G | ||||||
Alternative sequence | VSP_062055 | 360-364 | in isoform 3 | |||
Sequence: SLGSS → WVLPH | ||||||
Alternative sequence | VSP_062056 | 365-482 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_062057 | 454-455 | in isoform 1 and isoform 4 | |||
Sequence: ES → GW | ||||||
Alternative sequence | VSP_062058 | 456-482 | in isoform 1 and isoform 4 | |||
Sequence: Missing |
Polymorphism
The sequence shown corresponds to the translation of the reference genome assembly (GRCh38/hg38) with Ser at position 360. This variant p.Gly360Ser is associated with an increased risk for sarcoidosis.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF186593 EMBL· GenBank· DDBJ | AAF05530.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF186588 EMBL· GenBank· DDBJ | AAF05530.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF186589 EMBL· GenBank· DDBJ | AAF05530.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF186591 EMBL· GenBank· DDBJ | AAF05530.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF186592 EMBL· GenBank· DDBJ | AAF05530.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF186590 EMBL· GenBank· DDBJ | AAF05530.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY881999 EMBL· GenBank· DDBJ | AAX35330.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY881999 EMBL· GenBank· DDBJ | AAX35331.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL034394 EMBL· GenBank· DDBJ | CAI42180.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
Z84814 EMBL· GenBank· DDBJ | CAI42180.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
Z84814 EMBL· GenBank· DDBJ | CAC69895.2 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AL034394 EMBL· GenBank· DDBJ | CAC69895.2 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AL662796 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC119668 EMBL· GenBank· DDBJ | AAI19669.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
BC127642 EMBL· GenBank· DDBJ | AAI27643.1 EMBL· GenBank· DDBJ | mRNA | ||
AY684332 EMBL· GenBank· DDBJ | AAV91022.1 EMBL· GenBank· DDBJ | mRNA | ||
AY684333 EMBL· GenBank· DDBJ | AAV91023.1 EMBL· GenBank· DDBJ | mRNA |