Q9UHV9 · PFD2_HUMAN
- ProteinPrefoldin subunit 2
- GenePFDN2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids154 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | mitochondrion | |
Cellular Component | nucleus | |
Cellular Component | prefoldin complex | |
Cellular Component | protein folding chaperone complex | |
Cellular Component | RPAP3/R2TP/prefoldin-like complex | |
Molecular Function | amyloid-beta binding | |
Molecular Function | protein folding chaperone | |
Molecular Function | unfolded protein binding | |
Biological Process | chaperone-mediated protein folding | |
Biological Process | negative regulation of amyloid fibril formation | |
Biological Process | positive regulation of cytoskeleton organization | |
Biological Process | protein folding | |
Biological Process | protein stabilization |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePrefoldin subunit 2
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9UHV9
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 164 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000124835 | 1-154 | Prefoldin subunit 2 | |||
Sequence: MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS |
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Heterohexamer of two PFD-alpha type and four PFD-beta type subunits (By similarity).
Component of the PAQosome complex which is responsible for the biogenesis of several protein complexes and which consists of R2TP complex members RUVBL1, RUVBL2, RPAP3 and PIH1D1, URI complex members PFDN2, PFDN6, PDRG1, UXT and URI1 as well as ASDURF, POLR2E and DNAAF10/WDR92 (PubMed:31738558).
Interacts with URI1; the interaction is phosphorylation-dependent and occurs in a growth-dependent manner (PubMed:17936702).
Component of the PAQosome complex which is responsible for the biogenesis of several protein complexes and which consists of R2TP complex members RUVBL1, RUVBL2, RPAP3 and PIH1D1, URI complex members PFDN2, PFDN6, PDRG1, UXT and URI1 as well as ASDURF, POLR2E and DNAAF10/WDR92 (PubMed:31738558).
Interacts with URI1; the interaction is phosphorylation-dependent and occurs in a growth-dependent manner (PubMed:17936702).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9UHV9 | DBI P07108-2 | 3 | EBI-359873, EBI-12847580 | |
XENO | Q9UHV9 | P0C045 | 4 | EBI-359873, EBI-9351969 | |
BINARY | Q9UHV9 | PDRG1 Q9NUG6 | 4 | EBI-359873, EBI-307050 | |
BINARY | Q9UHV9 | PFDN1 O60925 | 5 | EBI-359873, EBI-356919 | |
BINARY | Q9UHV9 | PFDN5 Q99471 | 7 | EBI-359873, EBI-357275 | |
BINARY | Q9UHV9 | POLR3A O14802 | 2 | EBI-359873, EBI-2515113 | |
BINARY | Q9UHV9 | RAC1 P63000 | 3 | EBI-359873, EBI-413628 | |
BINARY | Q9UHV9 | RPAP3 Q9H6T3 | 3 | EBI-359873, EBI-356928 | |
BINARY | Q9UHV9 | UQCRC1 P31930 | 3 | EBI-359873, EBI-1052596 | |
BINARY | Q9UHV9 | URI1 O94763 | 4 | EBI-359873, EBI-357067 | |
BINARY | Q9UHV9 | UXT Q9UBK9 | 4 | EBI-359873, EBI-357355 | |
BINARY | Q9UHV9 | VBP1 P61758 | 9 | EBI-359873, EBI-357430 | |
BINARY | Q9UHV9 | WSB2 Q9NYS7 | 2 | EBI-359873, EBI-719743 | |
BINARY | Q9UHV9 | ZNF726 A6NNF4-2 | 3 | EBI-359873, EBI-18338284 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 124-138 | Basic and acidic residues | ||||
Sequence: IRLMGEDEKPAAKEN | ||||||
Region | 124-154 | Disordered | ||||
Sequence: IRLMGEDEKPAAKENSEGAGAKASSAGVLVS |
Sequence similarities
Belongs to the prefoldin subunit beta family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length154
- Mass (Da)16,648
- Last updated2000-05-01 v1
- Checksum2FC68A7425412198
Sequence caution
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 14-22 | in Ref. 2; AAD47084 | ||||
Sequence: SGAGKGAVS → TPRRGRGRCP | ||||||
Sequence conflict | 15 | in Ref. 3; AAF36151 | ||||
Sequence: Missing | ||||||
Sequence conflict | 29-34 | in Ref. 3; AAF36151 | ||||
Sequence: GFNRLR → SFNAF | ||||||
Compositional bias | 124-138 | Basic and acidic residues | ||||
Sequence: IRLMGEDEKPAAKEN |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF117237 EMBL· GenBank· DDBJ | AAF17218.1 EMBL· GenBank· DDBJ | mRNA | ||
AF165883 EMBL· GenBank· DDBJ | AAD47084.1 EMBL· GenBank· DDBJ | mRNA | ||
AF151065 EMBL· GenBank· DDBJ | AAF36151.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
BC012464 EMBL· GenBank· DDBJ | AAH12464.1 EMBL· GenBank· DDBJ | mRNA | ||
BC047042 EMBL· GenBank· DDBJ | AAH47042.1 EMBL· GenBank· DDBJ | mRNA |