Q9UHD0 · IL19_HUMAN
- ProteinInterleukin-19
- GeneIL19
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids177 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Cytokine that functions as an anti-inflammatory and proangiogenic factor (PubMed:34932373).
Polarizes adaptive immunity to an anti-inflammatory phenotype through induction of T-helper 2 responses by both down-regulation of IFN-gamma and up-regulation of IL4 and IL13 (PubMed:16365913).
Produced by osteocytes, stimulates granulopoiesis and neutrophil formation (By similarity).
Exerts its biological effect through a receptor complex consisting of a heterodimer of IL20RA and IL20RB (PubMed:12351624).
In turn, activates the Janus kinase (JAK) and signal transducer and activator of transcription (STAT) pathway, and importantly, STAT3 (PubMed:11564763).
Polarizes adaptive immunity to an anti-inflammatory phenotype through induction of T-helper 2 responses by both down-regulation of IFN-gamma and up-regulation of IL4 and IL13 (PubMed:16365913).
Produced by osteocytes, stimulates granulopoiesis and neutrophil formation (By similarity).
Exerts its biological effect through a receptor complex consisting of a heterodimer of IL20RA and IL20RB (PubMed:12351624).
In turn, activates the Janus kinase (JAK) and signal transducer and activator of transcription (STAT) pathway, and importantly, STAT3 (PubMed:11564763).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | extracellular space | |
Molecular Function | cytokine activity | |
Biological Process | apoptotic process | |
Biological Process | immune response | |
Biological Process | negative regulation of extrinsic apoptotic signaling pathway | |
Biological Process | negative regulation of low-density lipoprotein particle clearance | |
Biological Process | positive regulation of intrinsic apoptotic signaling pathway | |
Biological Process | reactive oxygen species metabolic process | |
Biological Process | signal transduction |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameInterleukin-19
- Short namesIL-19
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9UHD0
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_013077 | 175 | in dbSNP:rs2243191 | |||
Sequence: F → S |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 201 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-24 | |||||
Sequence: MKLQCVSLWLLGTILILCSVDNHG | ||||||
Chain | PRO_0000015379 | 25-177 | Interleukin-19 | |||
Sequence: LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA | ||||||
Disulfide bond | 28↔121 | |||||
Sequence: CLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQC | ||||||
Glycosylation | 56 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 75↔127 | |||||
Sequence: CCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQC | ||||||
Disulfide bond | 76↔129 | |||||
Sequence: CVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHC | ||||||
Glycosylation | 135 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | PRO_0000015379 | IL20RB Q6UXL0 | 4 | EBI-14023330, EBI-14022792 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 3 isoforms produced by Alternative splicing.
Q9UHD0-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length177
- Mass (Da)20,452
- Last updated2007-05-01 v2
- Checksum7CCFB052177DE408
Q9UHD0-2
- Name2
- Differences from canonical
- 1-1: M → MCTEGAFPHRSACSLPLTHVHTHIHVCVPVLWGSVPRGM
Q9UHD0-3
- Name3
- Differences from canonical
- 122-177: QEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA → VSHWVRIPASAPCLPKERPGSAGPHRPPDMVLGVKGNSLRTSTGRTVENLSQWPLLPQGSLPADNSSDGLLLDNPPGVTNLCQHIP
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_046253 | 1 | in isoform 2 | |||
Sequence: M → MCTEGAFPHRSACSLPLTHVHTHIHVCVPVLWGSVPRGM | ||||||
Alternative sequence | VSP_057193 | 122-177 | in isoform 3 | |||
Sequence: QEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA → VSHWVRIPASAPCLPKERPGSAGPHRPPDMVLGVKGNSLRTSTGRTVENLSQWPLLPQGSLPADNSSDGLLLDNPPGVTNLCQHIP |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF276915 EMBL· GenBank· DDBJ | AAG16755.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY040367 EMBL· GenBank· DDBJ | AAK91776.1 EMBL· GenBank· DDBJ | mRNA | ||
AF453946 EMBL· GenBank· DDBJ | AAN40906.1 EMBL· GenBank· DDBJ | mRNA | ||
FJ380053 EMBL· GenBank· DDBJ | ACJ06540.1 EMBL· GenBank· DDBJ | mRNA | ||
AF192498 EMBL· GenBank· DDBJ | AAF06663.1 EMBL· GenBank· DDBJ | mRNA | ||
AF390905 EMBL· GenBank· DDBJ | AAK64498.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL513315 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL049615 EMBL· GenBank· DDBJ | CAB72342.1 EMBL· GenBank· DDBJ | Genomic DNA |