Q9UFW8 · CGBP1_HUMAN
- ProteinCGG triplet repeat-binding protein 1
- GeneCGGBP1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids167 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Binds to nonmethylated 5'-d(CGG)(n)-3' trinucleotide repeats in the FMR1 promoter. May play a role in regulating FMR1 promoter.
Miscellaneous
Binding is severely inhibited by complete or partial cytosine-specific DNA methylation of the binding motif.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor binding | |
Molecular Function | double-stranded DNA binding | |
Molecular Function | identical protein binding | |
Biological Process | epigenetic regulation of gene expression | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | regulation of gene expression |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCGG triplet repeat-binding protein 1
- Short namesCGG-binding protein 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9UFW8
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 137 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000252415 | 1-167 | UniProt | CGG triplet repeat-binding protein 1 | |||
Sequence: MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC | |||||||
Modified residue | 56 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 164 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 164 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Ubiquitous. Highly expressed in placenta, thymus, lymph nodes, cerebellum and cerebral cortex. Low expression in other regions of the brain.
Developmental stage
Expressed in fetal brain and kidney. Lower expression in fetal liver and lung.
Gene expression databases
Organism-specific databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9UFW8 | BOLA2-SMG1P6 A0A087WZT3 | 3 | EBI-723153, EBI-12006120 | |
BINARY | Q9UFW8 | CDC37 Q16543 | 3 | EBI-723153, EBI-295634 | |
BINARY | Q9UFW8 | CDKN2D P55273 | 3 | EBI-723153, EBI-745859 | |
BINARY | Q9UFW8 | CGGBP1 Q9UFW8 | 4 | EBI-723153, EBI-723153 | |
BINARY | Q9UFW8 | FAM124A Q86V42 | 3 | EBI-723153, EBI-744506 | |
BINARY | Q9UFW8 | GLRX3 O76003 | 3 | EBI-723153, EBI-374781 | |
BINARY | Q9UFW8 | GORASP2 Q9H8Y8 | 3 | EBI-723153, EBI-739467 | |
BINARY | Q9UFW8 | MRM1 Q6IN84 | 7 | EBI-723153, EBI-5454865 | |
BINARY | Q9UFW8 | NTAQ1 Q96HA8 | 3 | EBI-723153, EBI-741158 | |
BINARY | Q9UFW8 | PAX6 P26367 | 3 | EBI-723153, EBI-747278 | |
BINARY | Q9UFW8 | PIAS2 O75928-2 | 3 | EBI-723153, EBI-348567 | |
BINARY | Q9UFW8 | PICK1 Q9NRD5 | 3 | EBI-723153, EBI-79165 | |
BINARY | Q9UFW8 | POLR1C O15160 | 3 | EBI-723153, EBI-1055079 | |
BINARY | Q9UFW8 | REL Q04864 | 4 | EBI-723153, EBI-307352 | |
BINARY | Q9UFW8 | REL Q04864-2 | 3 | EBI-723153, EBI-10829018 | |
BINARY | Q9UFW8 | SDCBP O00560 | 3 | EBI-723153, EBI-727004 | |
BINARY | Q9UFW8 | TXN2 Q99757 | 3 | EBI-723153, EBI-2932492 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length167
- Mass (Da)18,820
- Last updated2006-10-17 v2
- Checksum1AF69CDB885BB8AD
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
C9JUJ0 | C9JUJ0_HUMAN | CGGBP1 | 106 |
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 165 | in Ref. 2; CAB55894 | ||||
Sequence: Q → R |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ000258 EMBL· GenBank· DDBJ | CAA03974.1 EMBL· GenBank· DDBJ | mRNA | ||
AF094481 EMBL· GenBank· DDBJ | AAD04161.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CR456854 EMBL· GenBank· DDBJ | CAG33135.1 EMBL· GenBank· DDBJ | mRNA | ||
AL117392 EMBL· GenBank· DDBJ | CAB55894.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AM393707 EMBL· GenBank· DDBJ | CAL38583.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471110 EMBL· GenBank· DDBJ | EAW68863.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471110 EMBL· GenBank· DDBJ | EAW68864.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC052980 EMBL· GenBank· DDBJ | AAH52980.1 EMBL· GenBank· DDBJ | mRNA |