Q9UBW7 · ZMYM2_HUMAN
- ProteinZinc finger MYM-type protein 2
- GeneZMYM2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1377 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 913-914 | Breakpoint for translocation to form ZMYM2-FGFR1 | ||||
Sequence: PV |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nucleus | |
Cellular Component | PML body | |
Molecular Function | ubiquitin conjugating enzyme binding | |
Molecular Function | zinc ion binding | |
Biological Process | negative regulation of DNA-templated transcription |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameZinc finger MYM-type protein 2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9UBW7
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Involvement in disease
Neurodevelopmental-craniofacial syndrome with variable renal and cardiac abnormalities (NECRC)
- Note
- DescriptionAn autosomal dominant disorder characterized by dysmorphic craniofacial features, mild developmental delay, mildly impaired intellectual development or learning difficulties, speech delay, and behavioral abnormalities. About half of patients have congenital anomalies of the kidney and urinary tract and/or congenital cardiac defects, including septal defects.
- See alsoMIM:619522
Natural variants in NECRC
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_086276 | 208-1377 | missing | in NECRC | |
VAR_086278 | 398-1377 | missing | in NECRC; does not localize to the nucleus; decreased interaction with FOXP1 and FOXP2 | |
VAR_086279 | 540-1377 | missing | in NECRC; does not localize to the nucleus; loss of interaction with FOXP1 and FOXP2 | |
VAR_086281 | 722-1377 | missing | in NECRC | |
VAR_086285 | 780-1377 | missing | in NECRC | |
VAR_086288 | 1082-1377 | missing | in NECRC |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_086274 | 61 | found in a patient with congenital anomalies of the kidney and urinary tract; likely benign; no effect on localization to the nucleus | |||
Sequence: Missing | ||||||
Natural variant | VAR_086275 | 126 | found in a patient with congenital anomalies of the kidney and urinary tract; likely benign; no effect on localization to the nucleus; no effect on transcriptional repression activity | |||
Sequence: E → A | ||||||
Natural variant | VAR_086276 | 208-1377 | in NECRC | |||
Sequence: Missing | ||||||
Natural variant | VAR_086277 | 387 | found in a patient with congenital anomalies of the kidney and urinary tract; likely benign; no effect on localization to the nucleus; no effect on transcriptional repression activity | |||
Sequence: I → V | ||||||
Natural variant | VAR_086278 | 398-1377 | in NECRC; does not localize to the nucleus; decreased interaction with FOXP1 and FOXP2 | |||
Sequence: Missing | ||||||
Natural variant | VAR_086279 | 540-1377 | in NECRC; does not localize to the nucleus; loss of interaction with FOXP1 and FOXP2 | |||
Sequence: Missing | ||||||
Natural variant | VAR_086280 | 649 | found in a patient with congenital anomalies of the kidney and urinary tract; likely benign; no effect on localization to the nucleus; no effect on transcriptional repression activity | |||
Sequence: K → R | ||||||
Natural variant | VAR_086281 | 722-1377 | in NECRC | |||
Sequence: Missing | ||||||
Natural variant | VAR_086282 | 763 | found in a patient with congenital anomalies of the kidney and urinary tract; likely benign; no effect on localization to the nucleus; no effect on transcriptional repression activity | |||
Sequence: Y → H | ||||||
Natural variant | VAR_086283 | 763 | found in a patient with congenital anomalies of the kidney and urinary tract; likely benign; no effect on localization to the nucleus; requires 2 nucleotide substitutions | |||
Sequence: Y → L | ||||||
Natural variant | VAR_086284 | 775 | found in a patient with congenital anomalies of the kidney and urinary tract; likely benign; no effect on localization to the nucleus; no effect on transcriptional repression activity | |||
Sequence: G → E | ||||||
Natural variant | VAR_086285 | 780-1377 | in NECRC | |||
Sequence: Missing | ||||||
Natural variant | VAR_086286 | 997 | found in a patient with congenital anomalies of the kidney and urinary tract; likely benign; no effect on localization to the nucleus | |||
Sequence: Missing | ||||||
Natural variant | VAR_086287 | 1031 | found in a patient with congenital anomalies of the kidney and urinary tract; likely benign; no effect on localization to the nucleus; no effect on transcriptional repression activity | |||
Sequence: E → K | ||||||
Natural variant | VAR_086288 | 1082-1377 | in NECRC | |||
Sequence: Missing |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1,386 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, cross-link, modified residue, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000191382 | 1-1377 | UniProt | Zinc finger MYM-type protein 2 | |||
Sequence: MDTSSVGGLELTDQTPVLLGSTAMATSLTNVGNSFSGPANPLVSRSNKFQNSSVEDDDDVVFIEPVQPPPPSVPVVADQRTITFTSSKNEELQGNDSKITPSSKELASQKGSVSETIVIDDEEDMETNQGQEKNSSNFIERRPPETKNRTNDVDFSTSSFSRSKVNAGMGNSGITTEPDSEIQIANVTTLETGVSSVNDGQLENTDGRDMNLMITHVTSLQNTNLGDVSNGLQSSNFGVNIQTYTPSLTSQTKTGVGPFNPGRMNVAGDVFQNGESATHHNPDSWISQSASFPRNQKQPGVDSLSPVASLPKQIFQPSVQQQPTKPVKVTCANCKKPLQKGQTAYQRKGSAHLFCSTTCLSSFSHKPAPKKLCVMCKKDITTMKGTIVAQVDSSESFQEFCSTSCLSLYEDKQNPTKGALNKSRCTICGKLTEIRHEVSFKNMTHKLCSDHCFNRYRMANGLIMNCCEQCGEYLPSKGAGNNVLVIDGQQKRFCCQSCVSEYKQVGSHPSFLKEVRDHMQDSFLMQPEKYGKLTTCTGCRTQCRFFDMTQCIGPNGYMEPYCSTACMNSHKTKYAKSQSLGIICHFCKRNSLPQYQATMPDGKLYNFCNSSCVAKFQALSMQSSPNGQFVAPSDIQLKCNYCKNSFCSKPEILEWENKVHQFCSKTCSDDYKKLHCIVTYCEYCQEEKTLHETVNFSGVKRPFCSEGCKLLYKQDFARRLGLRCVTCNYCSQLCKKGATKELDGVVRDFCSEDCCKKFQDWYYKAARCDCCKSQGTLKERVQWRGEMKHFCDQHCLLRFYCQQNEPNMTTQKGPENLHYDQGCQTSRTKMTGSAPPPSPTPNKEMKNKAVLCKPLTMTKATYCKPHMQTKSCQTDDTWRTEYVPVPIPVPVYIPVPMHMYSQNIPVPTTVPVPVPVPVFLPAPLDSSEKIPAAIEELKSKVSSDALDTELLTMTDMMSEDEGKTETTNINSVIIETDIIGSDLLKNSDPETQSSMPDVPYEPDLDIEIDFPRAAEELDMENEFLLPPVFGEEYEEQPRPRSKKKGAKRKAVSGYQSHDDSSDNSECSFPFKYTYGVNAWKHWVKTRQLDEDLLVLDELKSSKSVKLKEDLLSHTTAELNYGLAHFVNEIRRPNGENYAPDSIYYLCLGIQEYLCGSNRKDNIFIDPGYQTFEQELNKILRSWQPSILPDGSIFSRVEEDYLWRIKQLGSHSPVALLNTLFYFNTKYFGLKTVEQHLRLSFGTVFRHWKKNPLTMENKACLRYQVSSLCGTDNEDKITTGKRKHEDDEPVFEQIENTANPSRCPVKMFECYLSKSPQNLNQRMDVFYLQPECSSSTDSPVWYTSTSLDRNTLENMLVRVLLVKDIYDKDNYELDEDTD | |||||||
Cross-link | 48 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 88 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 98 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 104 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 147 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 159 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 253 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 297 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 303 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 305 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 305 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 309 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 312 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 325 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 348 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 366 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 417 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 441 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 491 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 503 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 513 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 529 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 532 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 576 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 603 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 620 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 623 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 624 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 649 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 658 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 688 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 700 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 709 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 764 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 788 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 812 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 829 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 833 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 838 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 838 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 840 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 958 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 958 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1056 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1060 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 1064 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 1376 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 1376 | PRIDE | Phosphothreonine | ||||
Sequence: T |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
May be a component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, KDM1A, RCOR1/CoREST, PHF21A/BHC80, ZMYM2, ZNF217, ZMYM3, GSE1 and GTF2I. Interacts with FOXP1 and FOXP2 (PubMed:32891193).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9UBW7 | GMCL1 Q96IK5 | 3 | EBI-2797576, EBI-2548508 | |
BINARY | Q9UBW7 | GTF2IRD1 Q9UHL9 | 5 | EBI-2797576, EBI-372530 | |
BINARY | Q9UBW7 | IKZF3 Q9UKT9 | 3 | EBI-2797576, EBI-747204 | |
BINARY | Q9UBW7 | PAICS P22234 | 3 | EBI-2797576, EBI-712261 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 85-115 | Polar residues | ||||
Sequence: TSSKNEELQGNDSKITPSSKELASQKGSVSE | ||||||
Region | 85-177 | Disordered | ||||
Sequence: TSSKNEELQGNDSKITPSSKELASQKGSVSETIVIDDEEDMETNQGQEKNSSNFIERRPPETKNRTNDVDFSTSSFSRSKVNAGMGNSGITTE | ||||||
Compositional bias | 150-177 | Polar residues | ||||
Sequence: TNDVDFSTSSFSRSKVNAGMGNSGITTE | ||||||
Region | 273-305 | Disordered | ||||
Sequence: NGESATHHNPDSWISQSASFPRNQKQPGVDSLS | ||||||
Zinc finger | 327-363 | MYM-type 1 | ||||
Sequence: VKVTCANCKKPLQKGQTAYQRKGSAHLFCSTTCLSSF | ||||||
Zinc finger | 369-409 | MYM-type 2 | ||||
Sequence: PKKLCVMCKKDITTMKGTIVAQVDSSESFQEFCSTSCLSLY | ||||||
Zinc finger | 421-456 | MYM-type 3 | ||||
Sequence: NKSRCTICGKLTEIRHEVSFKNMTHKLCSDHCFNRY | ||||||
Zinc finger | 463-502 | MYM-type 4 | ||||
Sequence: IMNCCEQCGEYLPSKGAGNNVLVIDGQQKRFCCQSCVSEY | ||||||
Zinc finger | 533-570 | MYM-type 5 | ||||
Sequence: LTTCTGCRTQCRFFDMTQCIGPNGYMEPYCSTACMNSH | ||||||
Zinc finger | 636-671 | MYM-type 6 | ||||
Sequence: QLKCNYCKNSFCSKPEILEWENKVHQFCSKTCSDDY | ||||||
Zinc finger | 723-758 | MYM-type 7 | ||||
Sequence: RCVTCNYCSQLCKKGATKELDGVVRDFCSEDCCKKF | ||||||
Zinc finger | 764-799 | MYM-type 8 | ||||
Sequence: KAARCDCCKSQGTLKERVQWRGEMKHFCDQHCLLRF | ||||||
Region | 983-1002 | Disordered | ||||
Sequence: LLKNSDPETQSSMPDVPYEP | ||||||
Region | 1028-1064 | Disordered | ||||
Sequence: VFGEEYEEQPRPRSKKKGAKRKAVSGYQSHDDSSDNS |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9UBW7-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length1,377
- Mass (Da)154,911
- Last updated2000-05-01 v1
- Checksum2652D4C766492FF9
Q9UBW7-2
- Name2
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A087X151 | A0A087X151_HUMAN | ZMYM2 | 276 |
Sequence caution
Features
Showing features for compositional bias, sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 85-115 | Polar residues | ||||
Sequence: TSSKNEELQGNDSKITPSSKELASQKGSVSE | ||||||
Sequence conflict | 102 | in Ref. 4; CAH56193 | ||||
Sequence: S → P | ||||||
Sequence conflict | 110 | in Ref. 7; AAH36372 | ||||
Sequence: K → E | ||||||
Compositional bias | 150-177 | Polar residues | ||||
Sequence: TNDVDFSTSSFSRSKVNAGMGNSGITTE | ||||||
Alternative sequence | VSP_039065 | 165-251 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 304 | in Ref. 4; CAB66556 | ||||
Sequence: L → V | ||||||
Sequence conflict | 330 | in Ref. 4; CAB66556 | ||||
Sequence: T → S | ||||||
Sequence conflict | 411-412 | in Ref. 1; CAA73875 | ||||
Sequence: DK → EQ | ||||||
Sequence conflict | 424 | in Ref. 4; CAB66556 | ||||
Sequence: R → G | ||||||
Alternative sequence | VSP_039066 | 529-549 | in isoform 2 | |||
Sequence: KYGKLTTCTGCRTQCRFFDMT → VSRNVNGVQGLNIFEHCYYCH | ||||||
Alternative sequence | VSP_039067 | 550-1377 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 736 | in Ref. 1; CAA73875 | ||||
Sequence: K → G | ||||||
Sequence conflict | 856 | in Ref. 7; AAH36372 | ||||
Sequence: T → I | ||||||
Sequence conflict | 967 | in Ref. 9; AAB88464 | ||||
Sequence: Missing | ||||||
Sequence conflict | 1009-1010 | in Ref. 9; AAB88464 | ||||
Sequence: DF → IS | ||||||
Sequence conflict | 1016 | in Ref. 9; AAB88464 | ||||
Sequence: Missing | ||||||
Sequence conflict | 1259 | in Ref. 7; AAH36372 | ||||
Sequence: C → R |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Y13472 EMBL· GenBank· DDBJ | CAA73875.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AJ224901 EMBL· GenBank· DDBJ | CAA12204.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ007676 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007677 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007678 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007679 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007680 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007681 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007682 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007683 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007684 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007685 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007686 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007687 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007688 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007689 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007690 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007691 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007692 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007693 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007694 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007695 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ007696 EMBL· GenBank· DDBJ | CAA07604.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL136621 EMBL· GenBank· DDBJ | CAB66556.2 EMBL· GenBank· DDBJ | mRNA | ||
BX647944 EMBL· GenBank· DDBJ | CAH56193.1 EMBL· GenBank· DDBJ | mRNA | ||
AL137119 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL138688 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471075 EMBL· GenBank· DDBJ | EAX08244.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471075 EMBL· GenBank· DDBJ | EAX08247.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC036372 EMBL· GenBank· DDBJ | AAH36372.1 EMBL· GenBank· DDBJ | mRNA | ||
AF060181 EMBL· GenBank· DDBJ | AAC23591.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AF035374 EMBL· GenBank· DDBJ | AAB88464.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AF012126 EMBL· GenBank· DDBJ | AAC01561.1 EMBL· GenBank· DDBJ | mRNA |