Q9U1W1 · TFG_CAEEL
- ProteinProtein tfg-1
- Genetfg-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids486 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
In its hexameric form, promotes the accumulation of sec-16A.1 and the COPII subunit npp-20 at endoplasmic reticulum exit sites (ERES), also known as transitional endoplasmic reticulum (tER), to positively regulate secretory cargo trafficking from the endoplasmic reticulum to the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and Golgi apparatus (PubMed:21478858).
Required for the assembly of proteins, such as the GTPase rab-6, at the Golgi apparatus (PubMed:21478858).
Plays a role in negatively regulating cell death and promoting cell and body growth (PubMed:18635357).
Required for the assembly of proteins, such as the GTPase rab-6, at the Golgi apparatus (PubMed:21478858).
Plays a role in negatively regulating cell death and promoting cell and body growth (PubMed:18635357).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | endoplasmic reticulum exit site | |
Cellular Component | endoplasmic reticulum-Golgi intermediate compartment | |
Cellular Component | mitochondrion | |
Molecular Function | identical protein binding | |
Biological Process | COPII vesicle coating | |
Biological Process | endoplasmic reticulum to Golgi vesicle-mediated transport | |
Biological Process | maintenance of protein localization in organelle | |
Biological Process | negative regulation of apoptotic process | |
Biological Process | protein secretion | |
Biological Process | regulation of cell growth | |
Biological Process | regulation of cell size | |
Biological Process | regulation of multicellular organism growth |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein tfg-1
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ9U1W1
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown in embryos results in lethality prior to hatching and an increased number of apoptotic cell corpses at the comma stage of embryogenesis (PubMed:18635357).
RNAi-mediated knockdown in developing larvae results in smaller adults which have reduced locomotory muscle and epidermal cell sizes, and reduced total body protein content (PubMed:18635357).
Cell size defects are suppressed in a ced-4 n1162 or ced-4 RNAi mutant background (PubMed:18635357).
RNAi-mediated knockdown results in smaller and poorly stacked endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and Golgi membranes, fragmentation of the endoplasmic reticulum and few Golgi networks (PubMed:21478858).
RNAi-mediated knockdown reduces the accumulation of sec-16A.1 and the COPII subunit npp-20 at endoplasmic reticulum exit sites (ERES) within the germline (PubMed:21478858).
Does not reduce the expression of sec-16A.1 and does not affect the localization of npp-20 to the nuclear envelope (PubMed:21478858).
RNAi-mediated knockdown causes the disassembly of the npp-20-containing heterotetrameric complex, resulting in monomeric npp-20 (PubMed:21478858).
RNAi-mediated knockdown results in defective secretory cargo trafficking from the endoplasmic reticulum to the ERGIC and Golgi apparatus, and the subsequence accumulation of secreted integral membrane proteins including snb-1, cav-1 and sqv-8 in the endoplasmic reticulum (PubMed:21478858).
RNAi-mediated knockdown results in disrupted retrograde trafficking of the GTPase rab-6 from the Golgi apparatus to the endoplasmic reticulum and causes the accumulation of rab-6 at enlarged early endosomes (PubMed:21478858).
RNAi-mediated knockdown in developing larvae results in smaller adults which have reduced locomotory muscle and epidermal cell sizes, and reduced total body protein content (PubMed:18635357).
Cell size defects are suppressed in a ced-4 n1162 or ced-4 RNAi mutant background (PubMed:18635357).
RNAi-mediated knockdown results in smaller and poorly stacked endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and Golgi membranes, fragmentation of the endoplasmic reticulum and few Golgi networks (PubMed:21478858).
RNAi-mediated knockdown reduces the accumulation of sec-16A.1 and the COPII subunit npp-20 at endoplasmic reticulum exit sites (ERES) within the germline (PubMed:21478858).
Does not reduce the expression of sec-16A.1 and does not affect the localization of npp-20 to the nuclear envelope (PubMed:21478858).
RNAi-mediated knockdown causes the disassembly of the npp-20-containing heterotetrameric complex, resulting in monomeric npp-20 (PubMed:21478858).
RNAi-mediated knockdown results in defective secretory cargo trafficking from the endoplasmic reticulum to the ERGIC and Golgi apparatus, and the subsequence accumulation of secreted integral membrane proteins including snb-1, cav-1 and sqv-8 in the endoplasmic reticulum (PubMed:21478858).
RNAi-mediated knockdown results in disrupted retrograde trafficking of the GTPase rab-6 from the Golgi apparatus to the endoplasmic reticulum and causes the accumulation of rab-6 at enlarged early endosomes (PubMed:21478858).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000450676 | 1-486 | Protein tfg-1 | |||
Sequence: MVHSNGAITSTILKARHADVVRKTSLHHANDLTLIDLVLNVQRLLALPSDANFVLKYKDEEGDLVTLAEDSDLLLALHTSGATLDVTVVVDSRAREAVHDVQKQVEQIKLDVGKLLGALSALDVAQIAEQSNTSVANLSAPKQSHHDNIVFQKSFEAAPPSPVPSEKAELPATIQPSVHEQFNHRPAHVEEEIPLENHYAPPPHQQIPDDLNTSFSSQPPPPIEQFGAIPPPNATIPSFPTSNAASPPVQEFAPPPPQQQQQQFQAPPPPMASHSSISSTPVQQQGFAPPQQFGGPPPSGPPSEYGGYAPPQQQQQQFGAPPPQGAPQQGFGAPPQGPPQGGPPQGSFGAPPPQQFHAPSPQSFGGPPPPVSSAPGNFAPPPQSGPPGAFAPPPSAFGAPQGPGGPGGYGPPPPGGPGAPGSYGPPQGGPGGFGPPPPGGPGAYGPPPTGFPPVGAPPPGAAGAPGGNPFARGPSATGYRQSPYQQ |
Proteomic databases
Expression
Tissue specificity
Expressed in intestinal, hypodermal and muscle tissues (PubMed:21478858).
Highly expressed in the reproductive system (PubMed:21478858).
Highly expressed in the reproductive system (PubMed:21478858).
Developmental stage
Expressed throughout embryogenesis (at protein level) (PubMed:18635357).
First expressed at the two-cell stage of embryogenesis (at protein level) (PubMed:18635357).
First expressed at the two-cell stage of embryogenesis (at protein level) (PubMed:18635357).
Gene expression databases
Interaction
Subunit
Hexamer (PubMed:21478858).
The N-terminus assembles into an octamer and the C-terminus forms a dimer thus the N-terminus mediates its oligomerization, whereas the C-terminus restricts the full-length protein to form hexamers in solution in vitro (PubMed:21478858).
Interacts (via N-terminus) with sec-16A.1; the interaction is direct and is required for both the localization of tfg-1 and to maintain the distribution of sec-16A.1 at endoplasmic reticulum exit sites (ERES) (PubMed:21478858).
The N-terminus assembles into an octamer and the C-terminus forms a dimer thus the N-terminus mediates its oligomerization, whereas the C-terminus restricts the full-length protein to form hexamers in solution in vitro (PubMed:21478858).
Interacts (via N-terminus) with sec-16A.1; the interaction is direct and is required for both the localization of tfg-1 and to maintain the distribution of sec-16A.1 at endoplasmic reticulum exit sites (ERES) (PubMed:21478858).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, domain, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-195 | Required for interaction with sec-16A.1 | ||||
Sequence: MVHSNGAITSTILKARHADVVRKTSLHHANDLTLIDLVLNVQRLLALPSDANFVLKYKDEEGDLVTLAEDSDLLLALHTSGATLDVTVVVDSRAREAVHDVQKQVEQIKLDVGKLLGALSALDVAQIAEQSNTSVANLSAPKQSHHDNIVFQKSFEAAPPSPVPSEKAELPATIQPSVHEQFNHRPAHVEEEIPL | ||||||
Domain | 10-91 | PB1 | ||||
Sequence: STILKARHADVVRKTSLHHANDLTLIDLVLNVQRLLALPSDANFVLKYKDEEGDLVTLAEDSDLLLALHTSGATLDVTVVVD | ||||||
Region | 197-486 | Disordered | ||||
Sequence: NHYAPPPHQQIPDDLNTSFSSQPPPPIEQFGAIPPPNATIPSFPTSNAASPPVQEFAPPPPQQQQQQFQAPPPPMASHSSISSTPVQQQGFAPPQQFGGPPPSGPPSEYGGYAPPQQQQQQFGAPPPQGAPQQGFGAPPQGPPQGGPPQGSFGAPPPQQFHAPSPQSFGGPPPPVSSAPGNFAPPPQSGPPGAFAPPPSAFGAPQGPGGPGGYGPPPPGGPGAPGSYGPPQGGPGGFGPPPPGGPGAYGPPPTGFPPVGAPPPGAAGAPGGNPFARGPSATGYRQSPYQQ | ||||||
Compositional bias | 207-221 | Polar residues | ||||
Sequence: IPDDLNTSFSSQPPP | ||||||
Compositional bias | 223-237 | Pro residues | ||||
Sequence: IEQFGAIPPPNATIP | ||||||
Compositional bias | 249-264 | Pro residues | ||||
Sequence: VQEFAPPPPQQQQQQF | ||||||
Compositional bias | 265-290 | Polar residues | ||||
Sequence: QAPPPPMASHSSISSTPVQQQGFAPP | ||||||
Compositional bias | 291-305 | Pro residues | ||||
Sequence: QQFGGPPPSGPPSEY | ||||||
Compositional bias | 308-323 | Polar residues | ||||
Sequence: YAPPQQQQQQFGAPPP | ||||||
Compositional bias | 327-464 | Pro residues | ||||
Sequence: PQQGFGAPPQGPPQGGPPQGSFGAPPPQQFHAPSPQSFGGPPPPVSSAPGNFAPPPQSGPPGAFAPPPSAFGAPQGPGGPGGYGPPPPGGPGAPGSYGPPQGGPGGFGPPPPGGPGAYGPPPTGFPPVGAPPPGAAGA |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length486
- Mass (Da)49,739
- Last updated2000-05-01 v1
- ChecksumA1788AC56E08B98C
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 207-221 | Polar residues | ||||
Sequence: IPDDLNTSFSSQPPP | ||||||
Compositional bias | 223-237 | Pro residues | ||||
Sequence: IEQFGAIPPPNATIP | ||||||
Compositional bias | 249-264 | Pro residues | ||||
Sequence: VQEFAPPPPQQQQQQF | ||||||
Compositional bias | 265-290 | Polar residues | ||||
Sequence: QAPPPPMASHSSISSTPVQQQGFAPP | ||||||
Compositional bias | 291-305 | Pro residues | ||||
Sequence: QQFGGPPPSGPPSEY | ||||||
Compositional bias | 308-323 | Polar residues | ||||
Sequence: YAPPQQQQQQFGAPPP | ||||||
Compositional bias | 327-464 | Pro residues | ||||
Sequence: PQQGFGAPPQGPPQGGPPQGSFGAPPPQQFHAPSPQSFGGPPPPVSSAPGNFAPPPQSGPPGAFAPPPSAFGAPQGPGGPGGYGPPPPGGPGAPGSYGPPQGGPGGFGPPPPGGPGAYGPPPTGFPPVGAPPPGAAGA |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX284601 EMBL· GenBank· DDBJ | CAB63398.1 EMBL· GenBank· DDBJ | Genomic DNA |