Q9SZR9 · AB9G_ARATH
- ProteinABC transporter G family member 9
- GeneABCG9
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids638 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Together with ABCG31, involved in pollen coat deposition of steryl glycosides required for pollen fitness (PubMed:24474628).
Together with ABCG11 and ABCG14, required for vascular development by regulating lipid/sterol homeostasis (PubMed:24112720).
Together with ABCG11 and ABCG14, required for vascular development by regulating lipid/sterol homeostasis (PubMed:24112720).
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane | |
Cellular Component | pollen coat | |
Molecular Function | ABC-type transporter activity | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | protein homodimerization activity | |
Biological Process | cotyledon vascular tissue pattern formation | |
Biological Process | glycoside transport | |
Biological Process | pollen wall assembly | |
Biological Process | stem vascular tissue pattern formation |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameABC transporter G family member 9
- Short namesABC transporter ABCG.9 ; AtABCG9
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9SZR9
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 387-407 | Helical | ||||
Sequence: FSGMKVAQIFIVSFLCGLLWW | ||||||
Transmembrane | 418-438 | Helical | ||||
Sequence: IGLLFFISSFWAFFPLFQQIF | ||||||
Transmembrane | 470-490 | Helical | ||||
Sequence: LPMELILPTCFLVITYWMAGL | ||||||
Transmembrane | 497-517 | Helical | ||||
Sequence: FFVTLLVLLVHVLVSGGLGLA | ||||||
Transmembrane | 534-554 | Helical | ||||
Sequence: VIMLTFLLAGGYYVQHVPVFI | ||||||
Transmembrane | 608-628 | Helical | ||||
Sequence: LVSALALTAMLVVYRVIAYIA |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Pollen grains of the double mutant abcg9 abcg31 shrivel up and collapse upon exposure to dry air, and exhibit an immature coat containing reduced levels of steryl glycosides, thus leading to a low viability (PubMed:24474628).
Defective in sterol (e.g. 24-methylene cholesterol) composition (PubMed:24112720).
Vascular patterning defects in cotyledons and the floral stem, with a stronger phenotype in plant missing also ABCG11 and ABCG14 (PubMed:24112720).
Defective in sterol (e.g. 24-methylene cholesterol) composition (PubMed:24112720).
Vascular patterning defects in cotyledons and the floral stem, with a stronger phenotype in plant missing also ABCG11 and ABCG14 (PubMed:24112720).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 43 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000240681 | 1-638 | ABC transporter G family member 9 | |||
Sequence: MDNQEVSMDVETPIAKTNDDRSLPFSIFKKANNPVTLKFENLVYTVKLKDSQGCFGKNDKTEERTILKGLTGIVKPGEILAMLGPSGSGKTSLLTALGGRVGEGKGKLTGNISYNNKPLSKAVKRTTGFVTQDDALYPNLTVTETLVFTALLRLPNSFKKQEKIKQAKAVMTELGLDRCKDTIIGGPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDSTTAQRIVSILWELARGGRTVVTTIHQPSSRLFYMFDKLLLLSEGNPVYFGLGSNAMDYFASVGYSPLVERINPSDFLLDIANGVGSDESQRPEAMKAALVAFYKTNLLDSVINEVKGQDDLCNKPRESSRVATNTYGDWPTTWWQQFCVLLKRGLKQRRHDSFSGMKVAQIFIVSFLCGLLWWQTKISRLQDQIGLLFFISSFWAFFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFLSRVVGDLPMELILPTCFLVITYWMAGLNHNLANFFVTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLTFLLAGGYYVQHVPVFISWIKYVSIGYYTYKLLILGQYTANELYPCGDNGKLRCHVGDFEGIKHIGFNSGLVSALALTAMLVVYRVIAYIALTRIGKTKSG | ||||||
Glycosylation | 111 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 139 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Present in flowers and siliques, at lower levels in leaves and stems, but barely in roots (PubMed:24112720, PubMed:24474628).
Accumulates in the phloem (PubMed:24112720).
Highly expressed in the tapetum of anthers (PubMed:24474628, PubMed:27634427).
Accumulates in the phloem (PubMed:24112720).
Highly expressed in the tapetum of anthers (PubMed:24474628, PubMed:27634427).
Developmental stage
In roots, observed in the central cylinder (PubMed:24112720).
Restricted to the petiole main vein (PubMed:24112720).
Present in rosette leaves vascular system (PubMed:24112720).
Expressed transiently during flower develoment in the anthers and developing siliques, mostly in the tapetal cell layer during pollen maturation (PubMed:24474628).
Also observed in phloem cells of the flower stem (PubMed:24112720).
Restricted to the petiole main vein (PubMed:24112720).
Present in rosette leaves vascular system (PubMed:24112720).
Expressed transiently during flower develoment in the anthers and developing siliques, mostly in the tapetal cell layer during pollen maturation (PubMed:24474628).
Also observed in phloem cells of the flower stem (PubMed:24112720).
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 37-292 | ABC transporter | ||||
Sequence: LKFENLVYTVKLKDSQGCFGKNDKTEERTILKGLTGIVKPGEILAMLGPSGSGKTSLLTALGGRVGEGKGKLTGNISYNNKPLSKAVKRTTGFVTQDDALYPNLTVTETLVFTALLRLPNSFKKQEKIKQAKAVMTELGLDRCKDTIIGGPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDSTTAQRIVSILWELARGGRTVVTTIHQPSSRLFYMFDKLLLLSEGNPVYFGLGSNAMDYFASVGYSPLV | ||||||
Domain | 369-575 | ABC transmembrane type-2 | ||||
Sequence: QQFCVLLKRGLKQRRHDSFSGMKVAQIFIVSFLCGLLWWQTKISRLQDQIGLLFFISSFWAFFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFLSRVVGDLPMELILPTCFLVITYWMAGLNHNLANFFVTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLTFLLAGGYYVQHVPVFISWIKYVSIGYYTYKLLILGQY |
Sequence similarities
Belongs to the ABC transporter superfamily. ABCG family. Eye pigment precursor importer (TC 3.A.1.204) subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length638
- Mass (Da)70,753
- Last updated2012-02-22 v2
- Checksum9ADE750F1A5E517B
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL078467 EMBL· GenBank· DDBJ | CAB43874.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AL161571 EMBL· GenBank· DDBJ | CAB81392.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002687 EMBL· GenBank· DDBJ | AEE85338.1 EMBL· GenBank· DDBJ | Genomic DNA |