Q9SZ13 · VA0E2_ARATH
- ProteinV-type proton ATPase subunit e2
- GeneVHA-e2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Subunit of the integral membrane V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | Golgi membrane | |
Cellular Component | proton-transporting V-type ATPase, V0 domain | |
Cellular Component | vacuole | |
Molecular Function | proton-transporting ATPase activity, rotational mechanism |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameV-type proton ATPase subunit e2
- Short namesV-ATPase subunit e2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9SZ13
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Multi-pass membrane protein
Golgi apparatus membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 1-21 | Helical; Name=1 | ||||
Sequence: MAFVVTSLIFAVVGIIASICT | ||||||
Transmembrane | 36-56 | Helical; Name=2 | ||||
Sequence: LTLVITATVCCWMMWAIVYIA |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000430418 | 1-70 | V-type proton ATPase subunit e2 | |||
Sequence: MAFVVTSLIFAVVGIIASICTRICFNKGPSTNLLHLTLVITATVCCWMMWAIVYIAQMNPLIVPILSEVE |
Proteomic databases
Expression
Gene expression databases
Interaction
Subunit
V-ATPase is a heteromultimeric enzyme composed of a peripheral catalytic V1 complex (components A to H) attached to an integral membrane V0 proton pore complex (components: a, c, c'', d and e).
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length70
- Mass (Da)7,685
- Last updated2000-05-01 v1
- ChecksumC40D8E9A76C220AB
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL035440 EMBL· GenBank· DDBJ | CAB36517.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL161565 EMBL· GenBank· DDBJ | CAB79526.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002687 EMBL· GenBank· DDBJ | AEE85243.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002687 EMBL· GenBank· DDBJ | AEE85244.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY093013 EMBL· GenBank· DDBJ | AAM13012.1 EMBL· GenBank· DDBJ | mRNA | ||
BT000074 EMBL· GenBank· DDBJ | AAN15393.1 EMBL· GenBank· DDBJ | mRNA | ||
AY084532 EMBL· GenBank· DDBJ | AAM61100.1 EMBL· GenBank· DDBJ | mRNA |